KEGG   Azotobacter vinelandii CA6: AvCA6_26700Help
Entry
AvCA6_26700       CDS       T02634                                 

Definition
(GenBank) hypothetical protein
  KO
K11890  type VI secretion system protein ImpM
Organism
avd  Azotobacter vinelandii CA6
Brite
KEGG Orthology (KO) [BR:avd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avd02044]
    AvCA6_26700
Secretion system [BR:avd02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AvCA6_26700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TagF_N
Motif
Other DBs
NCBI-ProteinID: AGK20798
UniProt: M9YNQ2
LinkDB All DBs
Position
complement(2736229..2736927)
Genome map
AA seq 232 aa AA seqDB search
MSMVAPIFQAETAVGWYGKIPAAGDFVMRQLPYPLLRAWERWMQSGLNALRQQGAQMLSQ
HYAVAPAWNFLLPAGLGCDAVQLGCLAPSHDRVGRHYPLAAILGVPPAEFDNALLEGAAP
FYRQVGEAILGAVRQGLSVEQLSDRLAAVPGDWRGRPPRGGAGDILAVLEPGAGDQGLAW
PELSLSFDARGATGFWWTHQGDGAPLQTHTHNGEPDDALFARLFGPQRGDVS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggtggcccccatcttccaggctgaaaccgccgtgggctggtacggcaagatc
ccggcggccggcgacttcgtgatgcgccagttgccttatccgctgctgcgcgcctgggag
cgctggatgcagagtggcctgaacgccctgcgccaacagggcgcgcagatgctgtcgcaa
cactacgccgtggcgccggcctggaatttcctgctgccggccggactgggctgcgacgcc
gtgcaactgggctgcctcgcgccgagccacgaccgggtcggtcgccactacccgctggcg
gcgatcctcggcgtaccgccggcggagttcgacaacgccctgctggaaggggcggcgccg
ttctaccgccaggtcggcgaggccattctcggcgccgtgcgccagggactttcggtcgag
caactgagcgaccggctggccgccgtgccgggcgactggcgggggcggccgccgcgtggc
ggtgccggcgacatcctcgccgtgctggagcccggagccggcgaccagggcctggcctgg
ccggaactgtcgctgtccttcgacgcccgcggcgcgaccggtttctggtggacccaccag
ggcgacggcgcgcccctgcagacccacacccacaacggcgaaccggacgatgcgctgttc
gcccgcctgttcggtcctcaacggggggacgtatcgtga

DBGET integrated database retrieval system