KEGG   Azotobacter vinelandii CA6: AvCA6_26720
Entry
AvCA6_26720       CDS       T02634                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:avd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AvCA6_26720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avd02044]
    AvCA6_26720
Secretion system [BR:avd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AvCA6_26720
SSDB
Motif
Pfam: DotU OmpA RskA Virul_fac_BrkB
Other DBs
NCBI-ProteinID: AGK20800
UniProt: M9YIZ1
LinkDB
Position
complement(2740538..2741830)
AA seq 430 aa
MGDTRMNLHADTFFDPLKPSASPAPERGDDGQEQSATPAQPIVSGGNPLVAAANPLLNLV
PQIGGTPQHPDPPQLRERLLDEIRQFEVRARAAGVPAETVMGARYCLCTTLDEAATLTPW
GGGGVWSAHSLLVSFHNETWGGEKFFQLLARLSQAPQEHIDLLELQYFCLMLGFEGRYRV
LDQGRSQLEALKQRLLQLIRKVRGEYPAALSPHWHDPVAAPPRVRRSLPVWVGAALAALL
CLGLFATFQWLLAGRSDAAFAAIDQLRLPRVLAVAPTPAAPEPRLAKLLEAEIRDGLVRV
SDEVDRSLVVLRGDGLFDSGAAQVIERFQPLLARIGDALNTTRGSVLVMGYTDNVPIRGL
RYASNWELSQARADTVKAQLQARLSDPGRVRAEGRGAADPVAPNDSPANRARNRRVEITL
LVPPGTEARP
NT seq 1293 nt   +upstreamnt  +downstreamnt
ctgggcgatacgcgaatgaacctgcacgccgataccttcttcgatcctctgaagccttcg
gccagcccggcgccggagcggggcgacgacggccaggagcagtccgccaccccggcgcag
cccatcgtcagcggcggcaacccgctggtggccgcggccaatccgctgctcaatctggtg
ccgcagatcggcggcaccccgcagcatcccgacccgccgcaactgcgtgagcgactgctc
gacgaaatccgccagttcgaggtgcgcgcgcgcgccgccggcgtgccggcggagaccgtg
atgggcgcgcgctactgcctgtgcaccaccctggacgaggccgccaccctgaccccctgg
ggcggcggtggggtctggtcggcgcacagcctgctggtcagcttccacaacgagacctgg
ggcggcgagaagttcttccagttgctggcgcggctgtcccaggccccgcaggagcacatc
gatctgctggagctgcagtatttctgcttgatgctcggcttcgagggccgctaccgggtg
ctggaccagggccgctcgcagctcgaagcgctcaagcagcgcctgctgcagttgatccgc
aaggtccgcggcgaatatccggccgcgctttcaccgcactggcacgatccggtcgcggcg
ccgcccagggtgcgccgcagcctgccggtctgggtcggcgccgcgctcgccgccctgctg
tgcctgggcctgttcgccaccttccagtggctgctggccggccgttcggacgcggccttc
gccgccatcgaccagttgcgcctgccgcgcgtgctcgccgtcgcgccgacgcccgcggcc
cccgagccgcgcctggcgaaactgctggaggcggagatccgcgacggcctggtgcgggtg
agcgacgaggtcgaccgcagcctggtcgtgctgcgcggcgacggcctgttcgattccggc
gcggcgcaggtgatcgagcgcttccagcccctgctggcgcgcatcggcgacgccctgaac
accacccgcggcagcgtgctggtgatgggctacacggacaacgtgccgatccgcggcctg
cgctacgcctccaactgggagctgtcccaggcccgcgccgataccgtcaaggcgcagttg
caggcgcgtctctccgaccccggacgggtgcgcgccgaagggcggggcgccgccgacccg
gtggcgcccaacgacagcccggccaatcgcgcacgcaaccggcgggtggaaatcaccctg
ctggtgccccccggaacggaggcacggccatga

DBGET integrated database retrieval system