KEGG   Azotobacter vinelandii CA6: AvCA6_29690Help
Entry
AvCA6_29690       CDS       T02634                                 

Gene name
fabI
Definition
(GenBank) NADH-dependent enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00061  Fatty acid biosynthesis
avd00780  Biotin metabolism
avd01100  Metabolic pathways
avd01130  Biosynthesis of antibiotics
avd01212  Fatty acid metabolism
Module
avd_M00083  Fatty acid biosynthesis, elongation
avd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AvCA6_29690 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AvCA6_29690 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AvCA6_29690 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avd01004]
    AvCA6_29690 (fabI)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AvCA6_29690 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AvCA6_29690 (fabI)
Lipid biosynthesis proteins [BR:avd01004]
 Fatty acid synthase
  Component type
   AvCA6_29690 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AGK17843
UniProt: M9YFA5
LinkDB All DBs
Position
3069199..3069993
Genome map
AA seq 264 aa AA seqDB search
MGFLAGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLKGRVEEFAAGWGSSPE
LCFPCDVASDEDIARVFEELGKKWDGLDCIVHSVGFAPGDQLNGDFTEVTSRDGFKIAHD
ISAYSFVALAKAGRELMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAASL
GPEGTRVNCISAGPIRTLAASGIASFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLA
SGISGEILYVDGGFNTTAMGPLED
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcgccggtaagcgcgtactgatcgtcggcgtcgccagcaaactgtccatc
gcctccggtatcgccgccgcgatgcaccgcgaaggtgccgaactggccttcacctatcag
aacgacaagctcaagggtcgggtcgaggagttcgccgccggctggggctccagccccgag
ctgtgcttcccctgcgacgtggccagcgacgaggacatcgccagggttttcgaggaactg
ggcaagaagtgggacggcctggactgcatcgtccactcggtcggcttcgcgcccggcgac
cagctcaacggcgacttcaccgaggtcaccagccgcgacggcttcaagatcgcccacgac
atcagcgcctacagcttcgtcgccctggccaaggccggccgcgagctgatgaaaggccgc
aacggcagcctgctgaccctgtcctacctgggtgccgagcgcaccatgcccaactacaac
gtgatgggcatggccaaggccagcctggaggccggcgtgcgctacctggccgccagcctc
ggcccggagggcacccgcgtcaactgcatctccgccggcccgatccgcaccctggccgcc
tccggcatcgccagcttccgcaagatgctggccgccaacgagcgccagacgcccctgcgc
cgcaacgtgaccatcgaggaagtcggcaacgccggcgccttcctctgttccgacctggcc
tcgggcatcagcggcgaaatcctctatgtcgacggtggcttcaacaccaccgccatgggg
ccgctggaagactga

DBGET integrated database retrieval system