KEGG   Azotobacter vinelandii CA6: AvCA6_29780Help
Entry
AvCA6_29780       CDS       T02634                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00020  Citrate cycle (TCA cycle)
avd00190  Oxidative phosphorylation
avd00650  Butanoate metabolism
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01120  Microbial metabolism in diverse environments
avd01130  Biosynthesis of antibiotics
avd01200  Carbon metabolism
Module
avd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AvCA6_29780 (sdhB)
   00650 Butanoate metabolism
    AvCA6_29780 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AvCA6_29780 (sdhB)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AvCA6_29780 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AvCA6_29780 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AGK18785
UniProt: M9YD90
LinkDB All DBs
Position
complement(3081336..3082037)
Genome map
AA seq 233 aa AA seqDB search
MQVSVYRYNPEQDSAPYMQNLNIDIDGKDLMVLDVLALIKERDGSFSYRRSCREGVCGSD
GMNLNGKNGLACITPLSSVVKEGKLIIRPLPGLPIIRDLVVDMSTFYKQYEKVQPYLQNN
TPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLADS
RDTKTQERLAAMDDPFSVFRCRGIMNCVYVCPKGLNPTKAIGHVRDMLLRSGT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagttagcgtttatcgctacaacccggagcaggactctgctccctacatgcagaat
ctgaacattgacatcgacggcaaggatctcatggtcctcgacgtcctggccctgatcaag
gagcgtgacggcagcttttcctaccgtcgctcctgccgcgaaggcgtgtgcggttccgac
ggcatgaacctgaacggcaagaatggcctggcctgcatcactccgctgtccagcgtagtg
aaggagggcaaactgatcattcgcccgctgcccggactgccgatcatccgcgacctggtc
gtggacatgagcaccttctacaagcagtacgagaaggtgcagccctacctgcaaaacaat
actcccgccccggccatcgagcgtctgcaaagcccggaagagcgcgagaagctggacggt
ctctacgagtgcatcctgtgcgcttgctgttcgacctcctgtccgtccttctggtggaac
ccggacaagttcctcggtcccgccgcactgctgcaggcctatcgtttcctggccgacagt
cgcgacaccaagacccaggaacgtctggctgccatggatgacccgttcagcgtattccgt
tgccgcggcatcatgaactgcgtgtatgtctgcccgaaaggcctgaacccgaccaaggcc
atcggtcacgtgcgcgacatgttgctgcgtagcggtacctaa

DBGET integrated database retrieval system