KEGG   Azotobacter vinelandii CA6: AvCA6_29790Help
Entry
AvCA6_29790       CDS       T02634                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00020  Citrate cycle (TCA cycle)
avd00190  Oxidative phosphorylation
avd00650  Butanoate metabolism
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01120  Microbial metabolism in diverse environments
avd01130  Biosynthesis of antibiotics
avd01200  Carbon metabolism
Module
avd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AvCA6_29790 (sdhA)
   00650 Butanoate metabolism
    AvCA6_29790 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AvCA6_29790 (sdhA)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AvCA6_29790 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AvCA6_29790 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: AGK18784
UniProt: M9YE74
LinkDB All DBs
Position
complement(3082067..3083386)
Genome map
AA seq 439 aa AA seqDB search
MYQGNLKAGTSFLNEWYAVDLVKNQDGAVVGVIALCIETGETVYIRCKAVVLATGGAGRI
YASTTNALINTGDGVGMALRAGVPVQDIEMWQFHPTGIAGAGVLVTEGCRGEGGYLINAH
GERFMERYAPNAKDLAGRDVVARSMVKEVIAGNGVGPNKDHVLLKLDHLGEEVLHSRLPG
ICELSKTFAHVDPVVAPIPVIPTCHYMMGGVATNIHGQAITQDANGNDKIIEGLFAVGEV
ACVSVHGANRLGGNSLLDLVVFGRAAGLHLEKALKEGIDTRGASESDIESSLKRLAGVNE
RTSGEEVAPLKQELQQCMQNYFGVFRTGEYMQKGIAQLAELRGRIAEVKINDKSQAFNTA
RVEALELQNLLEVAEATAIAAETRKESRGAHAREDFEGRDDENWLCHTLYFPGEKRVAQR
AVNFAPKTVPAFEPKVRTY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ctgtaccagggtaacctgaaggctggtacctcgttcctcaacgagtggtatgccgtcgat
ctggtgaagaaccaggacggtgctgtggttggtgtcatcgctctctgcatcgaaaccggc
gaaaccgtttacatccgctgcaaggctgtggtcctggccacgggtggtgccgggcgtatc
tacgcttcgaccaccaacgcgctgatcaacaccggtgacggcgtaggcatggctctgcgt
gccggtgttccggttcaggacatcgagatgtggcagttccacccgaccggtattgctggt
gccggtgtactggtgaccgaaggctgccgcggcgaaggcggctacctgatcaatgcccat
ggcgagcgtttcatggagcgttatgcgccgaacgcgaaggatctcgccggtcgcgacgtg
gtggctcgttcgatggtcaaggaagtgatcgccggcaatggcgtcggtccgaacaaggac
cacgtgctgctgaagctcgaccaccttggcgaggaagtcctgcacagccgcctgcccggc
atctgcgagctgtccaagacttttgcccatgttgaccctgtggttgcgccgatcccggtc
atcccgacctgccactacatgatgggtggtgtggccaccaacatccatggccaggccatc
acccaggatgccaacggcaacgacaagatcatcgaaggcctgttcgccgtgggcgaagtg
gcctgcgtatctgtccatggcgccaaccgtctgggcggcaactcgctgcttgacctggtg
gtgttcggtcgcgctgctggcctgcacctggagaaagccctcaaggaaggtatcgatacc
cgcggagccagcgagtccgacatcgagagctccctcaagcgtctggctggcgtgaacgaa
cgtaccagtggcgaggaagtcgctccgctcaagcaggaactgcagcagtgcatgcagaac
tacttcggcgtattccgcaccggcgaatacatgcagaagggcatcgcccaactggccgag
ctgcgtggtcgtattgccgaagtcaagatcaacgacaagagccaggcgttcaacaccgct
cgcgtcgaggctctcgaactgcagaacctgctcgaagtggccgaggccaccgcgatcgcc
gcggaaacccgcaaggaatcccgtggcgcccacgcccgcgaggacttcgaaggccgcgac
gacgagaactggctgtgccacaccctgtacttcccgggtgagaagcgcgtggctcagcgt
gccgtcaacttcgcgccgaagaccgttccggcgtttgaacccaaagtacgtacttattaa

DBGET integrated database retrieval system