KEGG   Azotobacter vinelandii CA6: AvCA6_30470Help
Entry
AvCA6_30470       CDS       T02634                                 

Gene name
sodA
Definition
(GenBank) CU-Zn Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
avd  Azotobacter vinelandii CA6
Brite
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AvCA6_30470 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Adeno_E1B_55K_N
Motif
Other DBs
NCBI-ProteinID: AGK18813
UniProt: M9YI84
LinkDB All DBs
Position
3156669..3157211
Genome map
AA seq 180 aa AA seqDB search
MYNKEMPMKKRLIAAMIASCALPLQAAPLSVALNAVGADGIGAALGTVSIEQSEYGLVFT
PNLSGLQPGIHGFHIHASGDCGTTEKEGQKVAAGAAGGHWDPQNATRHGQPWGEGHLGDL
PALYVDANGKATQPVLAPRLKDLEAIKGRALMVHAGGDNHADSPAPLGGGGARVACGVIK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaaggagatgcccatgaaaaaacggctgattgcagcaatgatcgccagttgc
gcactacccctgcaggccgcgccgctcagcgtcgccctcaacgcggtgggcgccgacggc
ataggcgcagcgctcggcaccgtcagcatcgagcagagcgaatacggcctggtcttcacc
cccaacctctccggcctgcagcccggcatccatggcttccacattcatgcctcgggcgac
tgcggcaccacggagaaggaaggccagaaggtcgccgcaggcgccgcaggcggccactgg
gacccgcagaacgccaccaggcacggccagccctggggagaaggccatctgggcgatctg
ccggccctctacgtggacgccaacggcaaggccacgcagccggtactggccccgcgactg
aaggacctggaagcgatcaagggacgagccctgatggtgcatgccggcggcgacaatcat
gccgacagccctgccccgctgggcggtggcggagcccgggtggcctgcggagtcatcaag
taa

DBGET integrated database retrieval system