KEGG   Azotobacter vinelandii CA6: AvCA6_37820Help
Entry
AvCA6_37820       CDS       T02634                                 

Gene name
sodB
Definition
(GenBank) Fe-Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
avd  Azotobacter vinelandii CA6
Brite
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AvCA6_37820 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGK18814
UniProt: M9YEA6
LinkDB All DBs
Position
3824429..3825010
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPYISTETLEYHYGKHHNTYVVNLNNLIPGTEFEGKSLEDIVKTS
SGGIFNNAAQVWNHTFYWNGLKPQGGGQPTGPLADAINAAFGSFDKFKEEFTKVAIGTFG
SGWAWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAANYAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactgccgccgctgccgtacgagaaaaacgccctcgagccgtacatttcc
accgagaccctggaataccactacggcaagcaccacaacacctatgtggtgaacctgaac
aacctgatccctggtaccgagttcgaaggcaagagcctggaagacatcgtcaagacctct
tccggcggcatcttcaacaacgcggcccaggtatggaaccacaccttctactggaacggc
ctgaagccgcagggcggcggtcagccgaccggccccctggccgatgccatcaacgcggcc
ttcggttccttcgacaagttcaaggaagagttcaccaaggtcgccatcggcaccttcggc
tccggctgggcctggctggtgaagaaggccgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgacttccggcgacacgccgctgctgacctgcgatgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcattctggaac
ctggtgaactgggatttcgtggccgccaactacgccgcctga

DBGET integrated database retrieval system