KEGG   Azotobacter vinelandii CA6: AvCA6_39140Help
Entry
AvCA6_39140       CDS       T02634                                 

Definition
(GenBank) Glycosyl transferase, family 2
Organism
avd  Azotobacter vinelandii CA6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Cellulose_synt Glyco_hydro_17 Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: AGK21665
UniProt: M9YLF6
LinkDB All DBs
Position
3965293..3967884
Genome map
AA seq 863 aa AA seqDB search
MSSHKFGLNLVVVVAVAALFTGIWALYNLPVTAPDWPEQISGYSFSPFRPGQNPQENRYP
SDDEIRADLELLSRQTDSIRTYSVDGNLANVPRLAEELGLRVTLGIWISQDMERNEREIA
KAIELAKSSRSVVRVVVGNEALFRSEITPEALIAYIDRVRAAVKVPVTTSEQWHIWQEYP
ELGRHVDLIAAHILPYWEFVPMEDSVQFTLDRARDLKKLFPRKPLLLSEVGWPSNGRTRG
GAEATQIDQAIYLRTLVNTLNAQGYNYFVIEAFDQPWKIDDEGSVGAYWGVYNFERQPKF
AFEGPVVAIPQWRLLAVGSVVLAVLALALLLIDGSALRQRGRTFLTFVAFACGSILVWIG
YDYSQQYSTWFSLTVGFLLALGALGVFIVLLTEAHELAETVWTLKRRRPFPPVTADEAYR
PKVSIHVPCYNEPPEMVKQTLDALSRLDYPDFEVLVIDNNTKDPAVWKPLEEHCARLGPR
FRFFHVAPLAGFKGGALNYVLQYTAPDAEVVAVIDSDYCVERDWLKHMVPHFADPKIAVV
QSPQDYRDDRESAFKKLCYAEYKGFFHIGMITRNDRDAIIQHGTMTMTRRSVLDELGWAD
WCITEDAELGLRVFEKGLSAAYSERSYGKGLMPDTFIDFKKQRFRWAYGAIQIMKRHTRS
LLWGKESELTRGQRYHFLAGWLPWIADGLNIFFTLGALLWSAAMIIVPHRVDPPLLIFAI
PPLALFFFKVGKILFLYRRAVGVNLKDAFYAAIAGLALSHTIAKAVLYGFFTSSIPFFRT
PKMANNHGILVALAEAREEVVIMLVLWGAAAGIALVQGFPSNDVIFWVAVLLIQSLPYLA
ALIMALLSSQPKKVQEVPLVEAV
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgcataaattcggactcaatctggtggtggtcgtggcagtcgctgcgctcttc
accggaatctgggcgctctacaacctgccggtcaccgcgccggactggcccgagcagatc
tccggctactccttctcccccttccgccccgggcagaatccccaggaaaaccgctacccg
agcgacgatgaaatccgcgccgacctggagttgctcagccggcagaccgacagcatccgc
acctattcggtggacggcaacctggccaacgtgccgcgcctggccgaggagctgggcctg
cgcgtgaccctgggcatctggatcagccaggacatggagcgcaacgagcgggaaatcgcc
aaggccatcgagctggccaagagctcgcgcagcgtggtgcgcgtggtggtcggcaacgag
gcgctgttccgcagcgagatcactcccgaggcgctgatcgcctacatcgaccgggtccgc
gccgcggtcaaggtgccggtgaccacctccgagcagtggcacatctggcaggaatacccc
gagctgggccgccacgtcgacctgatcgccgcgcacatcctgccctactgggaattcgtg
ccgatggaggactccgtccagttcaccctcgaccgcgcccgcgacctgaagaaactgttc
ccgagaaagccgctgctgctctcggaggtcggctggccgagcaacggccgtacccgcggc
ggcgccgaggccacccagatcgaccaggcgatctacctgcgcaccctggtcaataccctg
aacgcccagggctacaactacttcgtcatcgaggccttcgaccagccctggaagatcgac
gacgagggctcggtcggtgcctactggggcgtctacaacttcgagcgccagcccaagttc
gccttcgagggaccggtggtggccattccccagtggcgcctgctggcggtcggctcggtg
gtcctcgccgtactggccctggctctgctgctgatcgatggcagcgcgctgcgccagcgc
ggacgcaccttcctgaccttcgtcgccttcgcctgcggctcgatcctggtgtggatcggc
tacgactacagccagcagtacagcacctggttcagcctcaccgtcggcttcctgctcgcc
ctcggtgcgctcggcgtgttcatcgtgctgctcaccgaggcccacgaactggccgagacg
gtatggacgctcaagcgccgccggccgttcccgccggtgaccgccgacgaagcctaccgg
cccaaggtgtcgatccacgtgccctgctacaacgaaccgccggagatggtcaagcagacc
ctcgacgccctctcgcgcctggactacccggacttcgaggtgctggtgatcgacaacaac
accaaggacccagcggtctggaagcccctcgaggagcactgcgcgcgcctcggcccgcgc
ttcaggttcttccacgtcgcgccgctggccggcttcaagggcggcgcgctgaactacgtg
ctgcagtacaccgcgccggacgccgaagtggtcgcggtgatcgactccgactactgcgtc
gaacgcgactggctcaagcacatggtgccgcacttcgccgacccgaagatcgccgtggtg
cagtcgccgcaggactatcgcgacgaccgcgaaagcgctttcaagaagctctgctacgcc
gaatacaagggcttcttccatatcggcatgatcacccgcaacgaccgcgacgcgatcatc
cagcacggcaccatgaccatgacccggcgttcggtgctggacgaactgggctgggccgac
tggtgcatcaccgaggacgccgagctgggcctgcgggtgttcgagaagggcctctcggcc
gcctattccgaacgcagctacggcaagggactgatgcccgacaccttcatcgacttcaag
aagcagcgcttccgctgggcctacggcgccatccagatcatgaagcgccatacccgcagc
ctgctgtggggcaaggagagcgagctgacccgcggccagcgctaccacttcctggccggc
tggctgccgtggatcgccgacgggctgaacatcttcttcaccctcggcgccttgctgtgg
tcggcggcgatgatcatcgtcccgcaccgggtcgacccgccgttgctgatcttcgccatc
ccgccgctggcgctgttcttcttcaaggtcggcaagatcctgttcctctaccgccgcgcg
gtgggcgtcaacctcaaggacgccttctacgccgcgatcgccggcctggcgctgtcgcac
accatcgccaaggcggtgctctacggcttcttcaccagcagcatcccgttcttccgcaca
ccgaagatggcgaacaaccacggcatcctggtggccctggcggaagcccgcgaggaggtg
gtgatcatgctggtgctgtggggcgcggccgccggcatcgccctggtgcagggcttcccg
agcaacgacgtgatcttctgggtggcggtcctgctgatccagtcgctgccctatctggcg
gcgctgatcatggcgctgctgtcgtcgcagccgaagaaggttcaggaggtcccgctcgtc
gaagccgtctga

DBGET integrated database retrieval system