KEGG   Archaeoglobus veneficus: Arcve_0209Help
Entry
Arcve_0209        CDS       T01451                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ave00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Arcve_0209
Enzymes [BR:ave01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Arcve_0209
DNA repair and recombination proteins [BR:ave03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Arcve_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEA46246
UniProt: F2KNL8
LinkDB All DBs
Position
185551..186525
Genome map
AA seq 324 aa AA seqDB search
MEDWFNRKIKPMLAVRGKPFSSDDYIYEIKWDGTRCIAFVDVGKKRLRLQNRRLIEIAYR
YPELDFFDFESQNAVLDGEIVVFHNGKPSFPLLQQRDHVDSRLKIEILSKRIPAVYIAFD
VLYTASDGWIMNLPLVERKKILDELAEEARRVTKSEFIEGAGVEFYRKAIEMGLEGVMAK
RKNSTYQPGKRSAAWVKMKKRKTLDCIIVGWLEGEGVREGKFGSLVLALKSGDKLVHVGQ
VGTGFESDFIDWFYEKLKEIEISKPWFEAEFKRRVHWVKPVYVCEVEFLEVTEDGKLRAP
VFLRLRDDKGPDECTVEGLYGLVD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagactggttcaacagaaaaatcaagccaatgctggcagtcagaggcaaacctttc
agcagtgacgactatatatatgagataaagtgggacgggacgcgctgcatagctttcgtt
gatgttgggaaaaagagacttagattgcaaaacagaaggctgattgagatagcgtatcgc
taccccgagcttgacttcttcgattttgagtcgcagaacgccgtgctcgatggagaaata
gtcgttttccataatggaaagccgtcgttcccccttttgcagcagagagatcacgttgac
agcaggctaaagattgaaatcctctcgaaaaggattcccgccgtttacatagccttcgac
gtgctttatacggcaagcgacgggtggataatgaatttaccattagtggaaaggaagaaa
attctcgacgaattggcggaagaggcaaggagggttacgaaatctgagtttatagaaggg
gcgggagtagaattttacagaaaggcaattgaaatgggactcgaaggcgtgatggccaag
cgtaaaaacagcacgtaccagccgggaaagaggagcgccgcatgggtcaagatgaagaag
cgaaagaccctcgactgtataatcgtcggctggctggagggcgagggggttagagaaggg
aagttcggttcccttgttttagccctgaaatcaggggataaactcgtccacgttggtcag
gttggcacaggcttcgagtccgacttcatagactggttctacgagaagctgaaggagatt
gaaattagcaagccatggttcgaagcagaattcaagcgaagagtgcactgggttaagcct
gtgtatgtctgtgaggtcgagtttctcgaagttactgaagacggaaagttaagggctcct
gtctttctgagactcagggatgataaggggccggatgagtgtaccgttgaggggctttat
ggcttggttgactga

DBGET integrated database retrieval system