KEGG   Archaeoglobus veneficus: Arcve_0786Help
Entry
Arcve_0786        CDS       T01451                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00630  Glyoxylate and dicarboxylate metabolism
ave01100  Metabolic pathways
ave01120  Microbial metabolism in diverse environments
ave01200  Carbon metabolism
Module
ave_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Arcve_0786
Enzymes [BR:ave01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Arcve_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEA46802
UniProt: F2KRW1
LinkDB All DBs
Position
complement(673069..674316)
Genome map
AA seq 415 aa AA seqDB search
MSFEWYTEFVDLSYEPEENEIICVFRVEPDGISMEEAAGRVASESSVGTWTTLAKLPERI
KRLMAKVFEIDGNVVKIAYPLDLFEEGSIPQLLSSVAGNVFGMKALKNLRLEDIEFPAEY
CKHFSGPLLGIEGVRKLFGVYDRPLTATVPKPKVGFDADEYADIAYQGWSGGIDFIKDDE
NLTSQPFVRFEKRLEKVMKAREKAEKETGEKKVYLANVTAVGKEMLRRAKLVADYGNEYV
MVDILTAGFSAVQMLREECEDLGLGIHAHRAMHAAFTRNPKHGISLDVLVKISRLAGVDN
FHVGTGVGKMEGSKDMVKRLADICRREWYVKPVFPVSSGGLHPGLVPDIVQLFGKDVIIQ
AGGGVHGHPDGTHAGAKALRQAIDAVIKGISLDEHAKKHAELARALEKWGYTRPK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaatggtacactgagtttgtcgatctaagctacgagccagaagaaaacgag
atcatatgcgtttttcgcgttgagcccgacgggatttcaatggaggaggctgccggaagg
gtcgcctcagagagctcagtcggaacgtggacaaccctcgcaaagcttccggagagaata
aagcgtctcatggcaaaggttttcgaaattgatggaaacgttgtaaagattgcctacccc
ctcgacctcttcgaagagggtagcatacctcagctactcagcagcgttgctgggaacgtt
ttcggcatgaaagctctgaaaaacctccgccttgaagacatagaatttccagcagagtac
tgcaaacatttctctgggccattgctcgggattgaaggagtaagaaagctcttcggcgtt
tacgacaggcctttaactgcaacggttccgaagccaaaggtcggattcgatgccgacgaa
tacgcagacattgcctatcagggatggtcaggaggaattgacttcataaaagacgacgag
aacctgacaagtcagcccttcgtgaggttcgagaagagactcgagaaggtcatgaaagcg
agagagaaggcagaaaaggaaacaggagaaaagaaggtctatctcgcaaacgtgacagca
gttggaaaggagatgctcagaagggcaaaactcgtcgcagattacggtaacgagtatgtc
atggtcgatatcttaactgccggattttcggcagttcagatgttgagagaggagtgtgaa
gatcttggccttggaattcacgcccacagagccatgcacgctgccttcacgagaaacccg
aagcacggaatttcactcgatgtccttgttaagatttcgaggctcgccggcgttgataac
ttccacgtgggcacaggcgttggcaagatggagggaagcaaggacatggtcaagaggctt
gcagacatatgcaggcgggaatggtacgtgaagcccgtatttcctgtctcctccggcggg
ttgcatcccggactcgttccagatattgtgcagctcttcggaaaggacgtcataatccag
gccggcggaggagtccatggacatccagacgggacgcacgctggagccaaagcactgagg
caggctatagatgcagtaataaagggtatatccctcgacgagcacgcgaaaaagcacgca
gagcttgccagagccctcgagaaatggggttacacgaggcccaagtaa

DBGET integrated database retrieval system