KEGG   Archaeoglobus veneficus: Arcve_1219Help
Entry
Arcve_1219        CDS       T01451                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00500  Starch and sucrose metabolism
ave01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arcve_1219
Enzymes [BR:ave01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Arcve_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 RNA_pol_Rpb2_4
Motif
Other DBs
NCBI-ProteinID: AEA47226
UniProt: F2KMM9
LinkDB All DBs
Position
1069915..1071390
Genome map
AA seq 491 aa AA seqDB search
MQTSEVCFAFEVHQPYRIDFQFNPEFAKRKRNLRDAYFAGINREILQRVVEKCYMPATQI
VLEGLDAGFKCAFSFSGTVVEQLERWNRDTLELFRQAAEHKNAEILAQTYYHSIASLFGE
RSEFEEQVKLHIQLMKDVFGVKPEVFENTELIFDSMIATVAKELGFKAVFAEGAERFLEG
RSPNYVYSCNGIKILLRNYTLSDDIAFRFSSGEWDQYPLTADKYADWLAATPGDCVNIFV
DYETFGEHHWKESGILDFLRWLPHECMKRGIEFATPSEVAELQAVGEIDVSETISWADVE
KDTSAWLGNWMQSTAFRAVKRAKAYAEYYNPVIWRYLQTSDHFYYMATKQGSSGEVHNYF
SQHHPFEAFSIYMRVLSHYEERCSSRMKSKQAAIALRSLPPEKAFHFRHFSGDYAGSAYS
LDDFASLLRSIPVESIRFHLENGDFERWIEYVLCDKRLVEEIRKLRREGDVVDGLVEVVE
KRRCELWRLLK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtctgaggtctgttttgcttttgaagtccatcagccttaccgcatcgacttt
cagttcaatcccgagtttgcaaagagaaaaagaaacctgagggatgcttacttcgccggt
attaatagggagattcttcagagagtggtggagaagtgctacatgcctgcaactcagata
gttctcgagggactcgatgcaggctttaaatgtgctttcagcttttcaggcacagttgtt
gagcagcttgaaagatggaaccgtgacacactcgagctcttcagacaggctgcagaacat
aaaaacgctgaaattcttgctcagacgtactatcacagcatcgcgagtcttttcggcgaa
aggagtgagttcgaggaacaggtaaagctccacattcagttaatgaaggatgtctttggt
gttaagccggaggtatttgagaacacggagttaatttttgacagcatgattgctaccgtt
gcgaaagaattaggcttcaaagcagtgtttgccgagggtgctgagagattcctcgaaggt
aggagtccaaattacgtttattcttgtaacggaataaaaattctgctgaggaactacaca
ctttccgatgacatagcgttccgtttctccagtggagagtgggatcagtatcctctgacg
gccgacaagtacgcagattggcttgctgcaacgcccggtgattgtgtgaacatctttgta
gattacgagacttttggagaacatcactggaaggaaagtggcattctcgatttcctgaga
tggctaccccacgagtgcatgaagagagggatagaatttgcaacgccatctgaagtggct
gagcttcaggcagttggcgaaatagatgttagcgagacgatatcctgggcagacgtggag
aaggacacttcggcgtggctcggcaactggatgcagagcacagcattcagagctgtcaaa
agggcgaaagcttacgctgaatactacaatccggtcatatggaggtatctccagaccagc
gaccacttctattacatggcaacgaagcagggttcgagcggagaagttcacaactacttc
agccagcaccatcctttcgaggctttttcaatttatatgagggttttatcacactacgag
gagcgttgctcgagcaggatgaaatcaaagcaggcagcaatcgctctccgctcacttccg
ccagagaaagcctttcacttcaggcacttctctggtgattacgcaggttcggcatacagc
ctcgatgactttgcctcgcttttgaggtccattccggtggagtccataaggtttcatctt
gagaacggggactttgaaaggtggatagagtacgttctgtgtgataaaaggcttgtagaa
gagattcgtaagcttaggagggaaggggatgtagtagatgggctggtagaagttgttgaa
aagagaaggtgtgagttatggagactcttaaaatag

DBGET integrated database retrieval system