KEGG   Agrobacterium vitis: Avi_0094Help
Entry
Avi_0094          CDS       T00851                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
avi  Agrobacterium vitis
Pathway
avi00564  Glycerophospholipid metabolism
avi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Avi_0094 (glpD)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Avi_0094 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored DUF1491 NAD_binding_8 STPPase_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACM35046
UniProt: B9JY16
LinkDB All DBs
Position
1:90949..92499
Genome map
AA seq 516 aa AA seqDB search
MRTVMLHCERERNVSGDPVFDIFVIGGGINGCGIARDAVGRGYTVALAEMNDFASGTSSG
ATKLIHGGLRYLEHYEFRLVREALMEREVLWAMAPHIIWPMRFVLPFHKGGIRPAWLIRL
GLFLYDHLGGRKLLPATKTLNMRKDKAGKPLKPLFTRAFEYSDGWVDDARFVVLNARDAA
DRGATILSRNRVIGAHRDGDLWIIEVEDRASRARSTYKARMLVNAGGPWVDSVLSNAVGR
NNVHNVRLVQGSHIVVKKKFDDPRAYFFQNPDNRIIFAIPYETDFTLIGTTDQDYQGDPK
DVKISSAEISYLCDAASEYFAEPVRPEDIVWSYSAVRPLYDDGASKAQEATRDYVLKLET
PEKAAPLLNVFGGKLTTYRRLGEHALEKIGEAIGVKGKPWTATSHLPGGDFPATGYLAEV
ERLKKVFPFLEDRCARRLVRCYGTFATTIINGAKSLEGLGHYFGGTLYQAEVDWLIAREW
AATAEDILWRRTKQGLFLSVEQAQVLEDYIEEARAA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactgtaatgctgcattgcgaaagggagagaaacgtgtccggcgatcctgtcttc
gacatattcgttattggtggtggcattaacggctgcggcattgcccgtgatgctgtcggg
cggggctataccgttgcgctggcggaaatgaatgatttcgcgtcaggcacctcttcgggt
gccaccaagctcattcacggcggcttgcgctatcttgaacattatgaatttcggctggtg
cgcgaagcgctgatggagcgtgaagtactctgggccatggcgccacatatcatctggccg
atgcgtttcgtgctgccgttccacaagggcggcattcgtcccgcctggctgatccggctg
ggcctgtttctctacgatcatctgggtggccgtaaattactgcccgccaccaaaacattg
aatatgcgcaaggacaaggcgggcaagccgctgaagcctctgtttacccgcgcctttgaa
tattcggatggctgggtcgatgatgcccgtttcgtcgtgctgaatgcccgcgatgctgcg
gatcgtggcgccacaatcctcagccgcaaccgcgtcattggcgcgcaccgggatggcgat
ctctggatcatcgaggtcgaggaccgcgccagccgcgcacgcagcacctacaaggcgcgg
atgctggtcaatgcaggcggcccatgggtcgatagcgtgctatccaatgcggtcggcaga
aacaatgttcacaacgtgcggctggtgcagggcagccatatcgtggtaaagaagaaattc
gatgatccccgtgcctatttcttccaaaatccggacaaccgtatcatcttcgccattccc
tatgagacggatttcaccctgatcggcacgaccgatcaggattatcaaggtgatccgaag
gatgtgaagatttccagcgccgagatctcctatctttgcgatgccgccagcgaatatttt
gccgagccggtccggcctgaggacattgtctggtcctattccgccgtgcggccactctac
gatgacggtgcttccaaagcgcaggaggccacccgcgattacgtgctgaaactggaaacg
ccggaaaaggccgcgccgctgcttaacgtattcggcggcaagctgaccacctatcggcgt
ctgggtgaacatgcattggaaaagatcggcgaggccatcggcgtcaagggcaagccctgg
accgcgacaagccatttgccgggcggtgattttccggcaaccggctatctggcggaagtg
gagaggctgaaaaaagtatttccattcctggaggaccgttgcgcgcgtcggctcgtgcgg
tgctatggcacgtttgccacgacgatcatcaatggtgccaaaagcctggaggggctgggg
cactatttcgggggaaccctgtatcaggcagaggtggactggctgattgctcgggaatgg
gcggcaacagcggaggatattctctggcgccgcaccaagcagggcctgttcctcagtgtc
gaacaggcacaggtgctggaagactatatcgaggaggcgcgggcggcctga

DBGET integrated database retrieval system