KEGG   Agrobacterium vitis: Avi_3277Help
Entry
Avi_3277          CDS       T00851                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
avi  Agrobacterium vitis
Pathway
avi00240  Pyrimidine metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Avi_3277 (tdk)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Avi_3277 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: ACM37349
UniProt: B9JZN9
LinkDB All DBs
Position
1:complement(2712038..2712616)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFNYAAMNAGKSTMLLQASYNYQERGMRTVIFVAALDDRAGRGRVASRIGLSSPAE
TFEPGTDLFAVVEAMHASEPIACVFVDEANFLSEHHVWQLARIADRLHIPVMAYGLRTDF
QGQLFPASRLLLGIADELREIRTICHCGRKATMNARFDASGQVMREGAQIEVGGNEKYVS
FCRLHWDELFNG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagctgtatttcaattatgccgccatgaatgccggtaaatccaccatgctgttg
caggcctcctacaattatcaggagcgcggtatgcgcacggtaatttttgtcgccgcactg
gatgatcgagccgggcgcgggcgggtcgcttcccgcattgggctttccagccccgccgaa
accttcgagccgggcaccgatctgtttgccgtggtcgaggccatgcatgcaagcgagccg
attgcctgcgtttttgtcgacgaggccaattttttgagcgagcaccatgtctggcaattg
gcgcggattgccgaccgcctgcatattccggtcatggcctatggcctgcgcacggatttc
cagggccagctgtttccggcctctcggttgctgctggggattgccgacgaattgcgcgaa
atccgcacgatctgccattgcggccgcaaggcgacgatgaatgcccgcttcgatgcgagc
ggccaggtgatgcgcgagggtgcgcagatcgaagttggcggcaacgagaaatatgtgtcc
ttctgccgcctgcattgggatgaactgttcaatgggtga

DBGET integrated database retrieval system