KEGG   Agrobacterium vitis: Avi_3752Help
Entry
Avi_3752          CDS       T00851                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avi  Agrobacterium vitis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2126 Bact_transglu_N Transglut_core
Motif
Other DBs
NCBI-ProteinID: ACM37696
UniProt: B9JS68
LinkDB All DBs
Position
1:3113434..3116778
Genome map
AA seq 1114 aa AA seqDB search
MAIKASIYHLTHYKYDTPIRLGPQIIRLKPAAHSRTKVLSHSLKVTPENHFVNLQQDPYG
NYLARFVFPDPVTEFKIEVDLTADMSIYNPFDFFTEEEAVTWPFEYPEDIREDLAIYKKP
EPDSPALDSYLKTLDMTPGQGTVDMIVALNARLQSEIGYVIRLEPGVQTPDETLTSARGS
CRDTSWLLVQILRHLGIAARFVSGYLIQLKPDLEALDGPSGTKVDFTDLHAWAEAYIPGA
GWIGLDPTSGLMTGESHIPLAATPHYKNAAPISGGYFGQAKTDFDFDMKVTRVAEHPRIT
KPFSDESWEALNALGLKVDGDLKAHDVRLTMGGEPTFVSIDDFQSAEWNTDAVGPTKRAL
ADQLIRKLRTRFAPGGFLHYGQGKWYPGESLPRWTFSLYWRKDGKPIWHNPDLIATETAD
TNVSHEQAQALMAGIATELEIEPDMILPAYEDPAAWIIKEGSLPENVDPSNSKLESPEER
ARIAKVFERGLTIPTGYILPVQAWNAKASGRRWISEKWRTRRGKIFLIPGDSPVGFRMPL
GTLPYVPPSQYPYIHTADPSIPRTPLPDFGPDAREGRALSEASRKTSDAQQDRNEQNIAG
STGDITGAVRTAMSVEPRDGRLCVFMPPVERIEDYLELVAAAETAAHNLGLPIHIEGYAP
PQDERINVIRVAPDPGVIEVNIHPADSWQDCVATTDIIYEEARQTRLGADKFMIDGRHTG
TGGGNHVVVGGANPGDSPFLRRPDLLKSLVLHWQRHPALSYMFSGMFIGPTSQAPRFDEA
RHDTLYELEIALAQIPMPDSGAAPPLPWLVDRLFRNLLTDVTGNTHRSEICIDKLFSPDG
PTGRLGLVEFRGFEMPPNARMSLAQQLLVRALIARFWKNPIGGNFVRWGTALHDRFMLPH
YLWQDFLEVLSDLREHGFDFKPEWFAAQLEFRFPFVGQVEYEDSKLELRQALEPWHVMGE
EGAIGGTVRYVDSSVERLQVKLETANPERYTIACNGRRLPLKKSGTNGVAVAGVRYKAWQ
PASGLHPVLPVNTPLTFDVYDIWTGRSIGGCVYHVAHPGGRSYDTFPVNGNEAEARRLAR
FEPWGHTAGSYPLWPEAVSPEFPHTLDLRRPHGI
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaggcaagcatttatcatctcacccattataaatatgacacgccgatccgc
ctggggccgcagatcattcgcctgaaaccggcggcccattccagaacaaaggttctgagc
cactccctcaaggtcacgcccgaaaatcacttcgtcaatctccagcaggacccctacggc
aactatctggcccgtttcgtgtttcccgatccggtcaccgagttcaagatcgaagtcgat
ctcaccgccgatatgagcatctacaatcccttcgatttcttcacggaggaagaggccgtt
acctggccgttcgaatacccggaggatatccgcgaggatctggcgatctacaaaaaaccg
gagccggacagccccgccctcgattcctatctcaagaccctggacatgacgccgggccaa
ggcacggtcgatatgatcgtcgcgctcaatgcccgcctgcaaagcgaaatcggctatgtc
atccgcctggagccgggcgtgcagacaccggatgaaacgctgacctcggcgcgtggctcc
tgccgagataccagctggctgctggtgcagattctccggcatctgggcattgccgcccgc
ttcgtctccggctatctgatccagctgaagccggatctggaagcgctggatggcccctcc
ggcaccaaggtggatttcaccgacctgcatgcctgggcggaagcctatattcccggcgcc
ggctggatcggcctggacccgacctccggcctgatgaccggcgaaagccatattccactg
gccgccacaccgcattacaaaaacgccgccccgatttccggcggctatttcgggcaagcc
aagaccgatttcgactttgatatgaaggtgacacgggttgccgagcatccgcgcatcacc
aagccgttttccgatgaaagctgggaagcactgaacgcgcttggcctgaaggtcgatggc
gatctgaaggcccatgacgtgcgcctgaccatgggcggcgaaccgaccttcgtgtcgatc
gacgatttccagtcggcggaatggaataccgatgcggttggcccgaccaagcgggcgctg
gccgatcagttgatccgcaagctgcgtacccgctttgcccccggcggcttcctgcattac
gggcagggtaaatggtatccgggtgaaagcctgccacgctggaccttctcgctctactgg
cgcaaggacggcaagccgatctggcataatccggacctgattgccacggagacagccgat
accaatgtgagccatgagcaggcccaggcgctgatggccggcattgccaccgagctggag
atcgagcctgacatgatcctcccggcctatgaagatcccgcagcctggatcatcaaggaa
ggcagcctgccggaaaatgtcgatccgtccaattccaagctggaaagccccgaagagcgc
gcccgcatcgccaaggtgttcgagcgcggcttgacgatcccgaccggctatatcctgccg
gtccaggcctggaacgccaaggccagcggtcggcgctggatcagcgagaaatggcgcacc
cggcgcggcaagatcttcctgattccaggcgacagtcccgttggctttcgcatgccgctc
ggcaccctgccctatgtgccaccctcgcaatatccctatattcacacggcggacccatcc
atcccacgcacaccgctgccggatttcggcccggatgcccgcgaaggccgggcgctgtcg
gaagcctcgcgcaaaaccagcgacgcccagcaggaccgcaacgaacagaatattgccggc
tcaaccggtgacataaccggcgccgtgcgcaccgccatgagcgtcgagccgcgtgatggc
cggctctgcgtgttcatgccgccggtggagcggatcgaggactatctggaactggtagcc
gccgccgagaccgctgcgcacaatctcggcctgccgatccacatcgaaggctatgcccca
ccgcaagacgagcgcatcaatgtcatccgcgtcgcccccgatcctggggttatcgaggtc
aacatccaccccgccgatagctggcaggattgcgtggccaccaccgatatcatctatgaa
gaggcccgccagacgcggcttggcgccgataagttcatgatcgatggccgccataccggc
accggcggcggcaaccatgtggtggttggcggcgccaatcccggcgacagcccgttcctg
cgccgcccggatctgctgaaaagcctggtcctgcattggcagcgccatccggctttgtcc
tatatgttctcgggcatgtttatcggcccgaccagccaggcgccacgctttgacgaggcc
cgccatgatacgctctatgagctggaaattgcgctggcccagatccccatgccagacagt
ggcgcggccccgcctttgccctggctggtcgaccggctatttcgcaacctgctgaccgat
gtcaccggcaatacgcatcgctcggaaatctgcatcgacaagctgttttcgcctgacggt
ccaacggggcggctgggtctggttgaattccgtggctttgaaatgccaccgaatgcccgc
atgtcgctggcccagcaattgctggtgcgggcgctgatcgccaggttctggaagaacccg
atcggtggaaatttcgtgcgctggggcacggcattgcacgaccgcttcatgctgccgcat
tatctctggcaggattttctcgaagtgttgtcagacctgcgcgaacacggcttcgacttc
aagccggaatggtttgccgcccagctggaattccgcttccccttcgtcggacaggtagaa
tacgaagacagcaaactggagctgcgccaggcgctggagccctggcatgtgatgggcgag
gaaggtgccatcggcggtacggtgcgctatgtcgatagttccgttgagcgtttacaggtc
aagctggagaccgccaatcccgagcgctacaccattgcctgcaatggccgccgtctgccg
ctgaagaaaagcggcacaaatggcgtggccgtcgccggtgttcgctacaaggcctggcaa
ccggcatcaggcctgcatccggtcctgcctgtaaacacaccgctaacattcgacgtttat
gatatatggacagggcggtcgatcggtggttgtgtgtatcatgtcgcgcatcccggtggt
cgcagttatgatactttccctgtgaatggcaatgaagcggaggctaggcggcttgcgcgg
ttcgaaccctggggccatacagccggatcgtatccgctgtggccggaagccgtctcgccg
gaatttccgcacacattggatttgcggcgaccacatgggatctaa

DBGET integrated database retrieval system