KEGG   Agrobacterium vitis: Avi_5896Help
Entry
Avi_5896          CDS       T00851                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
avi  Agrobacterium vitis
Pathway
avi00910  Nitrogen metabolism
avi02010  ABC transporters
Module
avi_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Avi_5896 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Avi_5896 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avi02000]
    Avi_5896 (nrtB)
Transporters [BR:avi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Avi_5896 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Flavi_NS2A
Motif
Other DBs
NCBI-ProteinID: ACM38936
UniProt: B9K238
LinkDB All DBs
Position
2:complement(908899..909792)
Genome map
AA seq 297 aa AA seqDB search
MSASLRKAEPATITAPQSAGTVVAMARRPTRRFNSQRIGANVLRNVVPPFVVLAILLGIW
QIACSHAGATLPPPSQVWEEAHDLITAPFFNNGPQDIGLGLRVLVSLERVAIGFGLAAIV
GVFLGAVVGQSIWAMRGLDPIFQILRTVPPLAWLPLSLAAFQNSNPSAIFVIFITSIWPV
IINTAVGVRNIPDDYRNVARVLRLNPLEFFIRIMVPAAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLSDIIVALAYIGVTGFVLDKLVALLGSVITRGTAKN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaagtcttcgcaaagcagaacccgcaaccatcaccgcccctcaatcagctgga
acggtggttgccatggcacgccgccccactcgcaggttcaacagccagcgcatcggcgca
aatgtgctgcgcaatgtcgtgccaccattcgtcgttctcgccatcctgctgggcatctgg
cagatcgcctgttcccatgctggcgcgaccttgccgccgccaagccaggtctgggaagaa
gcccatgacctgatcacggcccccttcttcaacaatgggccgcaggatatcggccttggc
ctgcgcgttctggtgtcgctggagcgggtggcaatcggcttcgggctggcggcgattgtc
ggcgtctttctcggtgcggtggtcggccagagcatctgggcaatgcggggccttgacccg
atcttccagatcttgcgcaccgtgccgccgcttgcctggttgcctctgtcactcgcggcc
ttccagaattccaatccgtcggcaattttcgtgatcttcatcacctcgatctggccggtg
atcatcaacaccgccgtcggtgtgcgcaatattcccgacgattaccgcaatgttgcccgg
gtgctgcggctcaacccgctggaattcttcatccgcatcatggtgcctgccgccgcccct
tacatctttaccgggcttcgcatcggcgtcggcctgtcatggctggccatcgttgccgct
gaaatgctgaccggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcctcg
cggctctccgacatcattgtggcgcttgcctatatcggcgtgaccggctttgtcctcgac
aagctcgtcgctctccttggcagtgtcatcacccgtggcaccgcgaagaactaa

DBGET integrated database retrieval system