KEGG   Agrobacterium vitis: Avi_6080Help
Entry
Avi_6080          CDS       T00851                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00473  D-Alanine metabolism
avi01100  Metabolic pathways
avi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Avi_6080 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Avi_6080 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avi01011]
    Avi_6080 (alr)
Enzymes [BR:avi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Avi_6080 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:avi01011]
 Precursor biosynthesis
  Racemase
   Avi_6080 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACM39086
UniProt: B9K2I8
LinkDB All DBs
Position
2:complement(1103312..1104436)
Genome map
AA seq 374 aa AA seqDB search
MDMSISQDMNADAFSARLVIDLDALADNYRQLAAETTPAETSAVVKADAYGLGAARVGPA
LYRAGCRKFFVANVQEAAGLRQHLPGDAELFILNGLQPGAEPFAAANGFIPVLNSLEQLA
NWSKMASEFGRTLPAILQFDTGMSRLGFSPEEANVLAGDPALLSGLSIRYIMSHLASADD
SASTQNAAQFSVMRERLAQFPGIALCFSNSGGIFIDKQFHGALVRPGVALYGAVPSDLAG
RRMKPVVRVDAKVIQTRTVPAGACVGYGATYVATKETRLATIAIGYADGLPRCLSDRGAA
YYGDIRLPIVGRVSMDSMTLDISALPPGTLTLGSLVEMIGPHQSLEDVAQAAGTIAYEIL
TSLGHRYHRDYISA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtctatcagccaggatatgaatgccgatgcgttttccgcccgcctcgtgatc
gacctcgacgcgcttgccgacaattaccgccaattggccgctgagaccaccccggcggaa
acctccgccgtcgtcaaggccgatgcctatggccttggagccgcccgcgtcggccccgcg
ctctaccgggctggatgccggaagttcttcgtggcgaatgtgcaggaagccgccgggcta
aggcagcatttgcctggggatgccgaactgttcattctcaatggcttacagccgggtgca
gaaccctttgccgcagcaaatggcttcataccggtgctgaattcgctggaacagcttgcc
aactggtcgaaaatggcaagcgagttcggacgaaccctgcccgcgatcctgcaatttgat
accggtatgtcgcggctcggattttcaccggaagaagccaatgtgcttgcaggcgacccc
gccctgttatccggcctctccatccgctacatcatgagtcatctcgcctcagccgatgac
agcgccagcacccagaatgccgcgcaattttcggtcatgcgcgagcgattggcgcaattt
ccgggcattgccttgtgcttttccaattcgggcggcatctttatcgacaagcagtttcac
ggcgcgttggtccgccccggcgttgccctttacggtgcggtgcccagcgatctggcaggg
cgccgcatgaagccggtggtgcgggtcgatgcgaaggtgatccaaacccgaacggtacca
gccggagcctgcgtcggctacggcgcgacctatgtggccaccaaggaaacccggctggcc
accatcgccatcggttatgctgatggcctgccgcgttgcttgagcgaccgtggtgccgct
tactatggtgatatccgtttgccaattgtcgggcgggtttcgatggacagcatgacactc
gatatttcggccctgccacccggcacgttgacgctgggaagtctggtggagatgattggt
ccgcaccagagccttgaggatgtggcgcaagcggcgggcaccatcgcctatgaaatcctg
accagccttggtcatcgctatcaccgcgactatatttcagcataa

DBGET integrated database retrieval system