KEGG   Agrobacterium vitis: Avi_7362Help
Entry
Avi_7362          CDS       T00851                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
avi  Agrobacterium vitis
Pathway
avi00040  Pentose and glucuronate interconversions
avi00051  Fructose and mannose metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Avi_7362
   00051 Fructose and mannose metabolism
    Avi_7362
Enzymes [BR:avi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Avi_7362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACM40025
UniProt: B9K577
LinkDB All DBs
Position
pAtS4e:338738..339718
Genome map
AA seq 326 aa AA seqDB search
MTQLKFATRLNSFASCPKAEWPDLSGKPTMLQMVKRAAKVDGLTDLDLNYPDHVGEDPAV
LARQIGDTGLAINGFAMRYYTNSAFKIGAFTNPDPEVRREAIDLTKAGIDAARAAGSRLM
TLWLGQDGFDYAFQADYHTLWQHEIDGIREVCAHDPDCQISIEYKPNEPRSYSLMPDAAT
TLLAIRDVDMPNLGVTLDFAHVLYADEQPAFAAALIARHSRVLGVHLNDGYAKRDDGLMV
GAVHTQQTIELLRQIRKDGYDGAIYFDTFPDMTGLDPVHECEVNIQTVKRMLRIVDRLDQ
DNRLSGAIDRQDAVSAQAIVQELMLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagctgaaatttgcaacccgcctgaattcctttgcctcctgcccaaaggcagaa
tggccggacctgtccggcaagccgaccatgctgcaaatggtaaagcgtgccgcaaaagtc
gatgggctaacggatctcgatctcaattatcccgatcatgttggcgaagatcctgctgtt
ttggcccgccagattggcgatacgggcctggcaatcaatgggttcgccatgcgctattac
accaattccgccttcaagatcggcgcattcaccaatccagaccccgaggtccggcgggaa
gccatcgatctcaccaaggccggtattgacgcagcccgtgcagcaggcagccggttgatg
acgctctggctcggccaggatgggttcgattatgccttccaggcggattatcacaccctg
tggcaacacgaaattgatggaatccgtgaagtttgcgcccatgacccggattgccagatc
agcatcgagtacaagccgaacgaacctcggtcctacagcctgatgccagatgcggcaacg
acattgctggccatcagggatgtcgatatgcccaatcttggtgtgacgctggactttgcc
cacgttctctacgccgatgaacagccagcctttgccgccgccctgattgcccgccatagc
cgcgttctcggtgtgcatctgaacgatggctatgccaagcgcgacgatggcctgatggtg
ggcgcggtccacacccagcagaccatcgagcttctgcgccagatccgcaaggacggctac
gatggcgctatctacttcgacacgttcccggacatgacgggtctcgatcccgtccacgaa
tgcgaggtcaatatccagaccgtcaagcgcatgttgcggattgtcgatcgcctcgatcag
gacaatcgtctttcgggcgccatcgaccgtcaggatgccgtgtccgcgcaggccatcgtt
caggaactgatgctgggctaa

DBGET integrated database retrieval system