KEGG   Agrobacterium vitis: Avi_7572Help
Entry
Avi_7572          CDS       T00851                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
avi  Agrobacterium vitis
Pathway
avi00500  Starch and sucrose metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Avi_7572
Enzymes [BR:avi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Avi_7572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ACM40176
UniProt: B9K5M8
LinkDB All DBs
Position
pAtS4e:complement(517027..519432)
Genome map
AA seq 801 aa AA seqDB search
MTTLVDFAPGNPGIQARWTSSAKSGLGTALSARSPVWFTLSHGVLNEVYYPRVDSACIRD
LGLLVIGPEGYFSEEKRDCTTTTHQVESGVLAFHVVNMSRDGRYRIEKQIISDPARATVL
QRITFMPLVGNISDYKVYALLAPHLVNAGMDNSAWIGEQDDTTLLFASGRSRYLALGSSL
PWAERSAGFAGQSDGYTQLLQNGSLDPQYQRADDGNTALTGQIPFTESANTAILALSFGQ
SETEAGAKALASLRDGFEAAFGMYCANWRGWQKGLYDLDRETAKPINMYRVSTAVLAAHR
AADRRGAVVASLSIPWGASKGDDDLGGYHLVWPRDLVESAGGFLAAGDWKEAIEILEYLR
EVQLASGRWPQNLWLDGKPYWLGVQMDECAFPILLADLLYRNGHLPETLLTRFLPMIRKA
AGYIIANGPATSQDRWEEDGGYSPFTLAVEIAALLAGADILDRVGEPDVAQHLRETADCW
NEQIENWTYTSDSTLCDAVGVGGYYVRIGGLDVTDVATGSQGQTIIRNRAADTSILPTRD
VISPDALALVRFGLRAADDPRILDTIKVIDHQLKIDLPQGPLWYRYTGDGYGEHPDGSPF
DGIGQGRPWPLLAGERAHYELAAGHRDVAERLLETLEASAGTEGLLPEQSWDGADLPERE
LFLGRPSGSAMPLVWAHAEYIKLLRSLNDGTVFDMPPQTVERYVKDQTPSTLRIWRFNNQ
ISTIPHGKTLRLELDASAMVHWSATGWHEVADTRTRETGLGTHVVDIDLADGAIGQELVF
TFFWEEADLWENANFKVQIIA
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccctcgtcgattttgctcccggcaatccaggaattcaagcgcgttggacgtcg
agcgcaaagagtggtttgggtactgcgctttccgcccggtctcccgtctggttcacgttg
agccatggggtgctgaatgaggtctattatcccagagtggacagcgcctgtattcgagat
cttgggttgctcgttattggtcctgaaggatatttttccgaggaaaagcgcgattgcacc
acaacgacccatcaggtcgaaagcggcgtactggcgtttcatgtcgtcaacatgtcacga
gatggccgctaccggatcgaaaagcagatcatttccgatcctgctcgcgcaaccgttctc
cagcgcatcacgttcatgcctttggtcggtaacatatccgattacaaggtctatgcgctg
cttgcgcctcatcttgtcaacgccgggatggataattccgcatggatcggtgagcaggat
gataccacgcttcttttcgcaagcggccgatcacgctatcttgcgcttggatcatcactt
ccttgggccgagcgatctgctggctttgccgggcagtccgatggctatacccaattgctg
caaaacggcagtctcgatccccaatatcagcgtgccgacgatggcaataccgcgctgacg
gggcaaatcccgttcacggaaagtgccaacaccgcaattctggcccttagctttggccag
tcggaaacggaagcgggcgcaaaggcactcgccagtctgcgcgatgggttcgaggccgca
ttcggcatgtattgcgcgaactggcgcggctggcaaaagggcctctacgatctggaccgc
gagaccgcaaagcccatcaatatgtaccgcgtctcgactgccgtgcttgcagcccatcgc
gctgctgatcggcgtggtgccgttgttgccagcctgtccattccttggggggcgagcaag
ggggatgatgatctgggtggctatcaccttgtctggcctcgcgatctcgtggaaagcgcg
ggcggctttctggctgctggcgactggaaggaagcaatcgaaatcctggaatatctgcgc
gaggttcagttggcgtccggtcgttggccgcagaatctctggctggatggcaagccctat
tggctcggggtgcagatggatgaatgcgcttttcctattctgctggccgatctcctgtat
cgaaatggacatctgccggaaacgctgctgacccgattccttccgatgatccgcaaggcg
gctggctacatcatcgcaaatgggcctgccaccagccaggaccgctgggaagaagatggc
ggttatagcccgttcaccctggccgtcgagatcgccgcattgctggccggcgcagacatt
ctggaccgtgttggagagcctgatgtggcccagcatttgcgcgaaaccgccgactgctgg
aatgagcagattgaaaactggacttataccagcgattccaccctttgcgatgccgtcggc
gtgggaggctattatgtccgtatcgggggtctcgatgtcactgacgtggcgacgggcagc
caaggacagaccattatccgcaaccgggcagccgatacgtcgatattgccgacccgtgac
gttatcagcccagacgccctggcgcttgttcgctttgggttgcgggccgctgatgatccg
aggatactcgacacgataaaggttatcgaccatcaattgaagatcgatctgccgcaaggt
ccgctctggtatcgctacacgggtgacggctatggcgaacatcctgatggcagcccgttc
gatggcatcgggcaggggcgtccgtggccattgctggcgggagagcgcgcgcattacgag
ctggcggctggacatcgcgacgtggccgaacggcttctggagacgcttgaggcttcggct
gggacagagggtcttcttcccgaacagagctgggacggagccgatctccccgaacgcgag
ttgttcctgggccgcccgtcaggcagtgccatgccactcgtctgggcgcatgcggaatac
atcaagctgttgcgttcgctgaacgatggcacggtttttgacatgccgccgcagaccgtt
gagcgctatgtaaaagatcagacgccatcaaccctgcgcatctggcgtttcaacaatcag
atttccaccataccccacggcaagacattgcggctggaactggacgcatcggccatggtg
cattggagcgccacgggctggcacgaggtggcggacaccaggacacgcgaaaccggtctc
gggacccatgttgtcgatatcgacctggcggacggcgcgatcggccaggaactggtgttc
accttcttctgggaggaggcggatctctgggaaaatgccaatttcaaagttcagatcata
gcttaa

DBGET integrated database retrieval system