KEGG   Agrobacterium vitis: Avi_8020Help
Entry
Avi_8020          CDS       T00851                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00500  Starch and sucrose metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Avi_8020
Enzymes [BR:avi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Avi_8020
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Avi_8020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ACM39560
UniProt: B9K4B0
LinkDB All DBs
Position
pTiS4:21013..22674
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVVYCLSVETFMDANGDGVGDFQGLQRRLDYLAGLGVNAIWLMPFQASPGL
DDGYDVSDYYNIDPRYGTLGDFVEFTHSAKQRGIRVLIDLVVNHTSDQHPWFKQACADKN
SRYRDWYVWSEKKPENADEGMVFPGVQKTTWTRDEKSGEYYFHRFFKFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIAEKGADVKESKPQFDLLRSFREFLQWRKGDSII
LAEANVVPKENLQYFGDDGDRMQMMFNFHVNQALFYALASADTRPLDKAMNETRERPQTG
QWGIFLRNHDELDLGRLTEKQRQAVFSAFGPDKDMQLYDRGIRRRLAPMLGGDTRRLRLA
YSLMYSLPGTPVLRYGDEIGMGDDLALEERNCARTPMQWSTEPHGGFTKAEKPVLPVIEG
GPYGFEHVNVAAQRRDAESMLNWTERMIRMRKEAPEIGWGSFSVLDCGDTGVLAMRYDWR
HNAVVIIHNLHDKPVDISFDPGVGESGRVLIDIADGSDSSADEKGRHNMVIEPFGYRWYR
AGGLDYLLKRSDI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaacgacctctggtacaagaacgctgtcgtctactgcctgtccgtcgagaccttc
atggatgccaacggcgatggagtgggcgattttcaggggctgcaacggcggttggattat
ctggccggtctgggcgtcaatgccatctggctgatgccgtttcaggcctctccgggtctc
gatgatggctacgatgtctccgactattacaacatcgatcccagatacggcaccctcggc
gacttcgtcgaattcacccatagcgcaaagcaacgcggtatacgggtgctgatcgacctc
gtcgtcaatcatacgtccgatcagcatccctggttcaaacaggcctgcgccgacaagaat
tcccgatacagggactggtacgtatggtctgagaagaagccggaaaatgccgacgagggc
atggtctttcctggtgtacaaaagaccacatggacacgggacgaaaagtccggcgaatac
tattttcaccgtttcttcaaattccagccggatctcaacaccagcaatccacatgtccag
gcggaaatcctcaagatcatgggtttctggatacagctcggcgtatcgggttttcgcatg
gacgccgttcccttcgtgatcgccgaaaagggtgcagatgtgaaggaatcgaagccgcag
ttcgatctgttgcgcagtttccgcgagttcctgcagtggcgcaagggtgacagcatcatc
cttgcggaggccaatgtcgtgcccaaggagaacctgcagtatttcggcgacgacggcgat
cgtatgcagatgatgttcaatttccacgtcaaccaggctctgttctacgcgctcgctagc
gccgatacccggccccttgacaaggcgatgaacgaaacccgggagcgaccgcaaacgggg
caatggggaatattcctgcgcaaccacgacgaactcgatcttggccggctgacggaaaaa
cagcggcaagccgtgttttccgccttcggtccagacaaggacatgcagctctatgatcgg
gggatacggcgtcgcctagcgccgatgctgggcggcgataccaggcgtctcaggcttgct
tatagcctgatgtattcgctgccgggcaccccggtcctgcgatatggtgacgagatcggc
atgggagacgacctagcattggaggagcgcaactgcgcccgcacgcctatgcaatggtcg
accgagccgcatggcggcttcaccaaggcggaaaaacccgtcttgcccgtcatcgaagga
ggtccctatgggttcgaacatgtcaatgtcgcggcacagcggcgggacgcggaatcgatg
ctgaactggaccgagcggatgatccgtatgcgaaaggaagcccctgaaatcggatgggga
agtttcagcgttctggactgcggcgataccggtgtcctggcgatgcgctacgactggcgc
cacaacgccgtcgtcatcatccacaatctccacgacaagccagtcgatatctcgttcgat
cccggcgtaggtgagagtggacgcgtcctgatcgacatcgccgacggcagcgacagcagc
gcggacgagaaaggccggcataacatggtgatcgagccattcggttatcgctggtaccgc
gccggcgggctcgattacctgctcaagagaagcgacatctga

DBGET integrated database retrieval system