KEGG   Agrobacterium vitis: Avi_9841Help
Entry
Avi_9841          CDS       T00851                                 

Definition
(GenBank) adenylate cyclase protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00230  Purine metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Avi_9841
Enzymes [BR:avi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Avi_9841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: ACM40309
UniProt: B9K611
LinkDB All DBs
Position
pAtS4a:complement(33821..35170)
Genome map
AA seq 449 aa AA seqDB search
MDKKSSPLGNSAATREIRSASLRFVVLSILFANLVFGDGLASFTTHVIVNSVYLIVSVAS
VAAAVYFPRQKHLGQLFVMLDAALVVVILYEHILANPITQDHNLTTSSLVVSFILLNHVG
LKLDRWLIVVFSTIVVSAWVLMLAIMAFRHHDSSPGTLLANFFNQDLGLTVSFAFTAMAV
YLLARDHDRTVRQALRIEEKRMNLSRFFSPTVVADLQTASASLDLERRDAAIMFVDIRDF
TSYAETASSRELACVLGEYRHIVAGAVFAYGGTVDKFIGDGVMAVFGQPKPKADDARRAL
ACALTLTEALEEWGGKKIEKGGPRLYAGIGLHYGTVLGGVLESGFHDEFTVIGDAVNVAQ
RLESLASLLKSPLVVSDRIIEEVPGMFGPNDWVYTNGVSIPGRKASVNIAYIRRTANLAS
PAGYETGDIHTDFKRSSFQSRPRIPLVGM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatcatcgccgttgggcaacagtgcagccacgcgggaaataaggtcagct
tcgctgcggttcgtggtgctttcgatcctattcgccaacctcgtgttcggtgacggcctc
gcgagctttaccacccatgtcatcgtcaattcggtgtatctgatcgtcagcgttgcatcc
gtcgcggcagctgtctatttccccagacaaaaacacctcggccagctgttcgtgatgctc
gacgccgccttggtcgtggtcattctctatgaacacattctggcaaacccaattacccaa
gatcataacctcacgacatcgagcctggtcgtgtcattcattcttttgaaccacgtgggc
ctgaagctcgatcgctggttgatcgtcgtgttttcgacgatcgtggtgtcggcatgggtc
cttatgcttgccatcatggcgttccgtcatcacgacagctcgcccggaacactattggcc
aacttcttcaaccaggacctcggccttacggtgagtttcgcgtttaccgcgatggcggta
tatctgctggcgcgcgatcacgaccgcactgtcaggcaggccttgagaatcgaggaaaag
cgcatgaacctgtcacgcttcttctcgccgacggtcgtcgccgatcttcagactgcaagt
gccagccttgacctcgagcggcgggacgcggcgatcatgtttgtcgatatccgggacttc
acgtcctatgcggaaaccgcttcctcacgcgagctcgcctgcgtcctcggtgagtatcga
cacatcgtcgccggcgctgtgttcgcctatggcgggactgtggacaagttcatcggcgat
ggggtgatggctgtgtttgggcagccgaagccaaaggcggacgacgcgcggcgggcattg
gcctgcgcgttgactttgaccgaggcgctcgaagaatggggcggtaagaaaatcgagaag
ggcggcccccgtttgtatgcgggtatcggcttgcactacggtacggttctcggcggcgta
cttgaaagcggtttccatgacgagttcaccgtgatcggtgacgccgtcaatgtcgcccaa
cgcctggagtctctggccagccttttgaaatcgccactcgtagtctcggaccgcataatc
gaagaagtcccgggtatgtttgggcccaatgattgggtgtacaccaatggcgtcagtatc
cctggcaggaaggcgtcggtcaacattgcctatatccgtcgcactgccaatcttgcatcg
cctgcgggctatgaaaccggggacatccataccgatttcaaaagatcttctttccagtcg
cgaccaaggataccgctcgttggaatgtaa

DBGET integrated database retrieval system