KEGG   Azotobacter vinelandii CA: AvCA_03470Help
Entry
AvCA_03470        CDS       T02633                                 

Definition
(GenBank) 4Fe-4S ferredoxin
Organism
avl  Azotobacter vinelandii CA
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_16 Fer4_7 Fer4_9 Fer4_2 Fer4_10 GF_recep_IV Fer4_4 Fer4_21 Fer4_17 Fer4_6 AFP Fer4_8
Motif
Other DBs
NCBI-ProteinID: AGK17337
LinkDB All DBs
Position
complement(326764..327015)
Genome map
AA seq 83 aa AA seqDB search
MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDSNLCTECVGHYDEPQCQQVCPVDCIP
HDENRVESREELMRKYLIITGKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaagatcaccgacgattgcatcaactgcgacgtctgcgaacccgagtgcccg
aacggcgccatctcccagggggaagagatctacgtgatcgactccaacctgtgcaccgag
tgcgtcggccactacgacgaaccccaatgccagcaggtctgtccggtggactgcatcccg
cacgacgagaaccgcgtcgagagtcgcgaggaactgatgcggaaatacctgatcatcacc
ggcaaagcctga

DBGET integrated database retrieval system