KEGG   Azotobacter vinelandii CA: AvCA_14920Help
Entry
AvCA_14920        CDS       T02633                                 

Gene name
fabG2
Definition
(GenBank) 3-ketoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00061  Fatty acid biosynthesis
avl00780  Biotin metabolism
avl01100  Metabolic pathways
avl01130  Biosynthesis of antibiotics
avl01212  Fatty acid metabolism
Module
avl_M00083  Fatty acid biosynthesis, elongation
avl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AvCA_14920 (fabG2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AvCA_14920 (fabG2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AvCA_14920 (fabG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avl01004]
    AvCA_14920 (fabG2)
Enzymes [BR:avl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AvCA_14920 (fabG2)
Lipid biosynthesis proteins [BR:avl01004]
 Fatty acid synthase
  Component type
   AvCA_14920 (fabG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGK12579
LinkDB All DBs
Position
1471868..1472611
Genome map
AA seq 247 aa AA seqDB search
MSLQGKVALVTGASRGIGQAIALELGRQGAVVIGTATSSSGAESIAETLKSNGIEGAGLV
LDVSSDESVATTLEHIQQHLGQPAILVNNAGITRDNLMLRMKDEEWHDVINTNLNSLYRL
SKAVLRGMTKARWGRIVNIGSVVGAMGNAGQVNYAAAKAGLEGFSRALAREVGSRGITVN
AVAPGFIDTDMTRELPEAQRNALLGQIPLGRLGQAGEIAQVVAFLASDGASYVTGATIPV
NGGMYMS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaaggcaaagtggcgttggtcaccggcgccagccgtggcatcggccaggcg
atcgcgctggagctgggccggcagggcgccgtggtgatcggcacggccacttcctcgagc
ggcgccgaaagcatcgccgagaccctgaagagcaatggcatcgagggtgccggtctggtg
ctggatgtatccagcgacgagtccgtcgccacgaccctggagcatatccagcagcatctc
ggccaacccgccatcctcgtcaacaatgccggcatcacccgcgataacctgatgttgcgg
atgaaagacgaggagtggcacgacgtcatcaataccaacctcaacagcctctatcgcctg
tccaaggcggtcctgcgcggcatgaccaaggcccgctggggacgcatcgtcaacatcggc
tcggtggtgggcgcgatgggcaatgccggtcaggtcaactatgcagccgccaaggccggg
ctggaggggttcagccgtgccctggcccgtgaggtcggctcgcgcgggatcaccgtcaat
gcggtggcgcccggtttcatcgataccgacatgacccgcgaactgcccgaggcgcagcgc
aatgcgctgctgggccagattccgctgggccgcctggggcaggcgggagagatagctcag
gttgtcgccttcctggcctccgatggtgcatcctatgtcaccggagctaccattccggtc
aacggtggaatgtacatgagttga

DBGET integrated database retrieval system