KEGG   Azotobacter vinelandii CA: AvCA_26980Help
Entry
AvCA_26980        CDS       T02633                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00500  Starch and sucrose metabolism
avl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AvCA_26980
Enzymes [BR:avl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AvCA_26980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGK14874
LinkDB All DBs
Position
2767633..2770098
Genome map
AA seq 821 aa AA seqDB search
MQQPARFRKTLLSVLIGALGIAQAAGAANMAPGAPGAAPFWSYSGKTGIGTSYEQYEDGQ
YSPQAATGEVSKVWFSLARGVVTETMFGLIHEAQLREMQLVIQGPDFLDLEAQDTDSEIH
YLSVDDQGRPTSLAYKIVNRDRQGRYEIEKHIFTDPDADSLVIRVIFRSQEPGIQAYVHI
DPAIGNDGSGDSAFVDGQALYAREGETTLVVKASRPLEQPTVGFAGVSDGLTDLKDGKLE
NRYDSTGDAAGNVTMLARLPLAGSETTLDLVVGFGKNRQQADRAADATLARGYAEVLAHY
NGEGEAIGWRDYLASLSGLPAMYAQSADNGKLLNVSAMVLKAQEDKSNAGALIASLSNPW
GETVPAESGTTGYKAVWPRDFYQCAMALLALGDRQTPQVAFEYLKKVQVSEATSLTQGDT
SAYIHEQKQEGKTEDAGPGATGWFLQKTHVDGEIEWVGVQLDQTAMPIMLGYKLWKAGIL
DDARIKHWYQNMLKPAAEFLTRGGQVKVGWNDWKVVPPQTQQERWEEQWGYSPSTTAAVI
AGLVAASEVAGHAGDGEAAQRFLDAAKGYSDKLEASMVTRKGSLGDGHYYLRITQNDDPD
DGAPLLDNNSRPGLPEHQVLDAGFLELVRYGVRPATDPNIVGSLDELDSQELPENLKVKY
LFSYPGVEGEFPGWRRYGNDGYGESEISAINFPATEAPQMNSGLRGRVWPIFTGERGHYE
LARSKARLPAGIEALSAEQLAQLRNTYVKAMELFANEGLMLPEQVWDGVGDNSRHGYVKG
EGTDSATPLAWSHAEYVKLVRSLTDQKVWDHYPVVPEKLAR
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaccagctagattccgcaaaacactgctgagcgtcctgatcggcgcactggga
atcgcccaggccgccggggcggccaacatggcccccggcgcgccgggcgcggcgccgttc
tggtcctattcgggcaagaccggcatcggtacttcctacgagcagtacgaggacggccag
tactcgccgcaagcggccaccggcgaagtctcgaaggtctggttctccctggcccggggg
gtcgtcaccgaaaccatgttcgggctgatccacgaagcccagctccgcgaaatgcaactg
gtgatccagggccccgacttcctggacctggaagcgcaggacaccgacagcgagatccac
tatctgtcggtcgacgatcagggccgccccacctcactggcctacaagatcgtcaaccgc
gacaggcagggccgctacgagatcgagaagcacatcttcaccgacccggacgccgattcg
ctggtgatacgggtcatcttccgcagccaggagccgggcatccaggcctatgtgcacatc
gatccggccatcggcaacgacggcagtggcgacagcgccttcgtcgacgggcaggcgctg
tacgcccgggagggcgagaccaccctggtggtcaaggccagccgccctctggaacaaccc
accgtcggcttcgccggagtttccgacggcctgaccgacctcaaggacggcaagctcgaa
aaccgctacgacagcaccggggatgctgctggtaacgtcaccatgctggcccgcctgccc
ttggcgggcagcgaaaccaccctcgacctggtggtcggcttcggcaagaaccgccagcag
gccgaccgggcggcagatgcgacgctggcgcgcggctacgccgaggtgctggcccactac
aacggcgagggcgaggcgatcggctggcgggactacctggcctccctttccggcctgccg
gccatgtacgcgcagagtgccgacaacggcaagctgctcaacgtcagcgccatggtgctc
aaggcacaggaagacaagagcaacgccggagcgctgatcgcctccctgtccaacccctgg
ggcgagacggtgccggcggaaagcggcaccaccggctacaaggcggtctggccgcgcgat
ttctaccagtgcgcgatggcgctgctggccctcggcgaccggcagacaccgcaggtcgcc
ttcgaatacctgaagaaggtccaggtcagcgaagccacctctctcacgcagggcgacact
tcggcctacatccacgagcagaagcaggaaggcaagaccgaagacgccggccccggcgcc
accggctggttcctgcagaagacccacgtcgatggcgagatcgaatgggtcggggtccag
ctcgaccagaccgccatgcccatcatgctgggatacaagctgtggaaggccgggatactg
gacgacgcccggatcaagcactggtaccagaacatgctcaagccggcggcggaattcctg
accaggggcggccaggtgaaggtcggctggaacgactggaaggtcgtcccgccgcagacc
cagcaggaacgctgggaagagcaatggggctactcgccctcgaccacggcggcggtcatc
gccggcctggtggcggcctccgaagtcgccggccatgccggggatggcgaggcggcgcag
cgtttcctggacgccgcgaagggctattccgacaagctggaggcgagcatggtcacccgg
aaaggcagcctgggtgacgggcactactatctgcgcatcacccagaacgacgaccccgac
gacggcgcccccctgctcgacaacaacagccgccccggattgccggaacatcaggtgctc
gatgccggcttcctggagctggtgcgctacggcgtacgccccgccaccgacccgaacatc
gtcggcagcctggacgaactcgatagccaggagctgccggaaaacctgaaggtcaaatac
ctgttcagctatccgggcgtcgagggcgaattccccggctggcgccgctacggcaacgac
ggctacggcgagagcgaaatttccgccatcaacttcccggccaccgaggccccgcagatg
aactccgggctgcgcggccgcgtctggccgatcttcaccggcgagcgcggccattacgag
ttggcccgcagcaaggcccgcttgccggcaggaatcgaggcactgagcgccgagcaactg
gcgcagttgaggaacacttacgtcaaggccatggagctgttcgccaacgagggcctgatg
ctgccggagcaggtctgggacggcgtaggcgacaacagccgccacggctacgtgaagggc
gaaggcacggactcggccacgcccctggcctggagccatgccgaatacgtcaagctggtc
cgctcgctgaccgaccagaaggtctgggatcactacccggtcgtcccggaaaaactcgcc
agatga

DBGET integrated database retrieval system