KEGG   Azotobacter vinelandii CA: AvCA_29050Help
Entry
AvCA_29050        CDS       T02633                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00061  Fatty acid biosynthesis
avl01100  Metabolic pathways
avl01212  Fatty acid metabolism
Module
avl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AvCA_29050 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avl01004]
    AvCA_29050 (fabA)
Enzymes [BR:avl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AvCA_29050 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AvCA_29050 (fabA)
Lipid biosynthesis proteins [BR:avl01004]
 Fatty acid synthase
  Component type
   AvCA_29050 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AGK12572
LinkDB All DBs
Position
2998725..2999240
Genome map
AA seq 171 aa AA seqDB search
MTKQHAYTREDLLRCARGELFGPGNAQLPAPNMLMVDRITHISDVGGKYGKGEMVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPT
AKKLTYNIHIKRTISRSLILGIADGTVSVDGREIYSAEGLRVGLFTSTDSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgcctatacccgggaagacctgctgcgctgcgctcgcggcgagctg
ttcggtccgggtaatgcgcaactgcccgcccccaatatgttgatggtcgatcgcatcacg
catatcagcgatgtcggcggcaagtacggcaagggcgaaatggtcgccgaactggacatc
aatcccgacctgtggttcttcgcctgccacttcgaaggagatccggtcatgcccggctgc
ctcggcctcgacgccatgtggcaactggtcggcttctacctgggctggcagggcaatccg
ggccgcggccgggcgctgggctcgggcgaagtcaaattcttcggccaggtgctgccgacg
gcgaagaaactcacctacaacatccacatcaagcgcaccatcagccgctcgctgatcctc
ggcatcgccgacggcacggtcagcgtcgatggccgcgagatctacagcgccgaaggcctg
cgcgtcggcctgttcacctctaccgacagcttctga

DBGET integrated database retrieval system