KEGG   Azotobacter vinelandii CA: AvCA_29060Help
Entry
AvCA_29060        CDS       T02633                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00061  Fatty acid biosynthesis
avl00780  Biotin metabolism
avl01100  Metabolic pathways
avl01212  Fatty acid metabolism
Module
avl_M00083  Fatty acid biosynthesis, elongation
avl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AvCA_29060 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AvCA_29060 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avl01004]
    AvCA_29060 (fabB)
Enzymes [BR:avl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     AvCA_29060 (fabB)
Lipid biosynthesis proteins [BR:avl01004]
 Fatty acid synthase
  Component type
   AvCA_29060 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AGK12870
LinkDB All DBs
Position
2999252..3000469
Genome map
AA seq 405 aa AA seqDB search
MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRYNPSYAEMGLRSQVSGSVDLDLEALI
DRKVYRFMGDAAAFAYLSMEQAIKDAGLTAEQISDPRVGLIAGSGGASTFNQMEAMDILR
DKGVKRVGPYRVPRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAMEQILMGKQ
DMVFAGGGEEEHWSQSFLFDAMGALSTQYNATPEKASRAYDAKRDGFVIAGGGGMVVVEE
LEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMQLALATVDGPIDYLNTHGTST
PVGDLAEAKAVRNVFGDKAPAISSTKSLSGHSLGAAGVQEAIYSLLMMEGDFIAGSANIE
ELDPEVADLPIVRQTRENVVLNTVMSNSFGFGGTNATLVFKRWQG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtcgtgatcactggcctcggcatcgtatcctgcctgggcaatgacaaggac
accgtatccgccaatctgcgtgccggccggccagggattcgctacaacccctcctatgcc
gaaatgggcctgcgcagccaggtatccggttccgtcgacctggacctggaagcgctgatc
gaccgcaaggtctaccgcttcatgggtgacgccgccgccttcgcctacctgtccatggaa
caggcgatcaaggacgccggcctgaccgccgaacagatctccgatccgcgtgtcggcctg
atcgcgggcagcggcggcgcttccaccttcaaccagatggaagccatggacatcctgcgc
gacaagggcgtcaagcgcgtcggtccctatcgcgtgccgcgcaccatgggcagcaccgtc
tccgcctgcctggccacgcccttcaagatcaagggcgtgaactactcgatctcctcggcc
tgcgccaccagcgcccactgcatcggcagcgccatggagcagatcctgatgggcaagcag
gacatggtcttcgccggcggcggcgaagaggagcactggagccagagcttcctgttcgac
gccatgggcgccctctccacccagtacaacgccaccccggagaaagcctcgcgcgcctat
gacgccaagcgcgacggcttcgtcatcgccggcggcggcggcatggtggtggtcgaggaa
ctggagcacgccctcaagcgcggcgcgaagatctacgccgaaatcgtcggctacggcgcc
acctccgacggctacgacatggtcgccccgagcggcgaaggcgcggtgcgttgcatgcaa
ctggcgctggccacggtcgacggcccgatcgactacctgaacacccacggcacctcgacc
ccggtcggcgacctggccgaagccaaggccgtgcgcaacgtgttcggcgacaaggccccg
gcgatcagctcgaccaagagcctgtccggccactcgctgggcgccgccggcgtgcaggaa
gcgatctacagcctgctgatgatggaaggcgacttcatcgccggctcggccaacatcgag
gaactggacccggaagtggccgacctgccgatcgtccgccagacccgcgagaacgtcgtc
ctgaacaccgtgatgagcaacagcttcggcttcggcggcaccaatgccaccctggtgttc
aagcgctggcagggctga

DBGET integrated database retrieval system