KEGG   Azotobacter vinelandii CA: AvCA_39300Help
Entry
AvCA_39300        CDS       T02633                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00620  Pyruvate metabolism
avl00680  Methane metabolism
avl01100  Metabolic pathways
avl01120  Microbial metabolism in diverse environments
avl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA_39300 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    AvCA_39300 (ppc)
Enzymes [BR:avl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AvCA_39300 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HAMP
Motif
Other DBs
NCBI-ProteinID: AGK12680
LinkDB All DBs
Position
complement(3979617..3982253)
Genome map
AA seq 878 aa AA seqDB search
MEEIDARLREDVRLLGELLGEYIHAQCGEVFFDKIERIRLGAKTGRLGSEEGAEQLTRTL
GELREDELQPVARAFNQFLNLANIAEQYHEIRRRAPEEPPPFAVRALPELLDRLLAGGHA
ADALARQLGRLEIDLVLTAHPTEVTRRTLIRKYEAIAAELAVLDHGDLLPAEREAVHERL
RRLIAEAWHTDEIRRSRPTPVDEAKWGFSVIEHSLWQAVPAFLRGVDRALHEATGLHLPL
EAAPIRFSSWMGGDRDGNPNVTAAVTREVLLLARWAAADLHLRDVEQLAAELSMQEASSE
LRARTGEVDEPYRVLLKQLRERLFATRDWAAAALHGEAVRSPAVLQNNRELLQPLELCYR
SLHACGMGLIADGPLLDSLRRAATFGLFLVRLDIRQDAARHAAALSEITEYLGLGRYADW
NEETRTAFLMRELDSRRPLLPVHFPASAETAEVLATCREVAQAPAASLGSYVISMAAAPS
DVLAVQLLLKECGLQRPMRVVPLFETLTDLDNAAPTVERLLLLPGYRARLHGPQEVMIGY
SDSAKDGGTTAAAWAQYRAQEGLVEVCRRQGVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVPGRFRTTEQGEMIRFKFGLPDTAVQSLNLYLSAVLEATLLPPPAPEPAWRELMDRLA
AEGLAAYRSVVREHPQFVEYFRQATPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFAWT
QTRLMLPAWLGWETALGNALARGEGELLRRMSRHWPFFGTRIDMLEMVLAKSDAAIAQLY
DERLVEPGLLPLGQQLRGLLSQACAAVLELTEQDRLLGHNPEVRAAFSVRNTYLDPLHLL
QVELLARYRLHQEQACSPLEQALLVSVAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaatcgacgcccgcctgcgcgaggacgtccgcctgctcggcgaactgctcggc
gaatatatccatgcccagtgcggtgaggtcttcttcgacaagatcgagcgcatccgcctg
ggggccaagacgggacgcctggggtcggaggagggcgccgagcagttgacccgtaccctg
ggcgagctgcgggaggacgagctgcagccggtggcgcgggccttcaaccagttcctcaac
ctggccaacatcgccgagcagtaccacgagatccgccgccgcgctcccgaggagccgccg
cccttcgcggtgcgcgccctgcccgaactgctcgaccggctgttggccggcggccatgcc
gcagacgcattggcccgccaactcgggcgcctggagatcgacctggtgctcaccgcccac
cccaccgaggtgacgcgccgtaccctgatccgcaagtacgaggcgatcgccgccgaactg
gccgtgctggatcatggcgatctgctgccggccgagcgcgaggcggtgcacgagcgcctg
cgccggttgatcgccgaggcctggcacaccgacgagatccgccgcagccggccgaccccg
gtggacgaggccaaatggggcttctcggtgatcgagcattccctctggcaggccgtgccg
gccttcctgcgcggcgtcgaccgcgcgttgcacgaggccaccggcctgcacctgccgctg
gaggcggcgccgatccgcttctcctcctggatgggcggcgatcgcgacggcaaccccaat
gtcaccgccgcggtcacccgcgaggtgctgctgctggcgcgctgggcggctgccgacctc
catctgcgcgacgtcgagcaactggccgccgagttgtccatgcaggaggcgagcagcgag
ctgcgcgcccggaccggcgaggtcgacgaaccctaccgggttctgctcaagcaactgcgc
gagcggctgttcgccactcgcgactgggccgcggcggccctgcacggcgaggccgtgcgt
tcgccggcggtgctgcagaacaaccgcgagctcctgcagccgctggaactctgctaccgc
tcgctgcatgcctgcggcatggggctgatcgccgacggtccgctgctcgacagcctgcgc
cgggcggccaccttcggcctgttcctggtgcgcctggacatccgccaggatgccgcccgg
catgccgcggcgctcagcgagatcaccgaatacctgggtctcggccgctacgccgactgg
aacgaggaaacccgtaccgcctttctgatgcgcgagctggacagccgccggccgctgttg
ccggtgcattttcccgcctccgcggaaaccgccgaggtcctcgccacctgccgcgaggtg
gcgcaggccccggcggcgtcgctgggctcctacgtcatctccatggccgcggcgccctcc
gacgtgctggccgtgcaactgctgctcaaggagtgcggcctgcagcggccgatgcgtgtg
gtaccgctgttcgaaaccctgaccgacctggacaacgccgcgccgacggtggagcggctc
ctgctgctgccgggctaccgcgcccgcctgcacggtccccaggaggtgatgatcggctat
tccgactcggccaaggacggcggcaccacggccgccgcctgggcacagtaccgcgcccag
gaaggcctggtggaggtctgccggcgacagggcgtcgaactgctgctgttccatggccgc
ggcggtaccgtcggtcgtggcggcggtccggcccatgcggcgatcctctcccagccgccg
ggctcggtgcccggacgctttcgcaccaccgaacagggcgagatgatccgcttcaagttc
ggcctgccggacaccgccgtgcagagcctgaacctctatctgtccgccgtcctcgaggcc
accctgctgccgccgccggcgccggagccggcctggcgcgaactgatggaccgcctggcc
gccgaggggctggccgcctatcgcagcgtggtgcgcgagcatccgcagttcgtcgaatat
ttccgccaggccacgcccgagcaggaactcggccgcctgccgctgggcagtcgcccggcc
aagcggcgggccggcgggatcgagagcctgcgggcgattccctggatcttcgcctggacc
cagacgcgcctgatgctgccggcctggctgggctgggagacggccctgggcaatgccctg
gcgcgcggcgagggcgaactgctcaggcggatgagccggcattggccgttcttcggcacg
cgcatcgacatgctggaaatggtcctggccaaatcggatgccgccatcgcccaactgtac
gacgagcggctggtggagccgggcctgcttcccctggggcagcaactgcgcggcctgttg
tcgcaggcctgcgccgccgtcctcgaattgacggagcaggatcgcctgcttggccacaat
cccgaggttcgtgccgccttcagcgtgcgcaatacttacctggatcctttgcatctgctg
caggtcgaactgctggcccgctaccgtctgcaccaggagcaggcctgcagccctctggag
caggcattgctggtgagcgtggcgggcatcgccgccggtctgcgcaacaccggctga

DBGET integrated database retrieval system