KEGG   Azotobacter vinelandii DJ: Avin_03470Help
Entry
Avin_03470        CDS       T00885                                 

Definition
(GenBank) 4Fe-4S ferredoxin
Organism
avn  Azotobacter vinelandii DJ
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_16 Fer4_7 Fer4_9 Fer4_2 Fer4_10 GF_recep_IV Fer4_4 Fer4_21 Fer4_17 Fer4_6 AFP Fer4_8
Motif
Other DBs
NCBI-ProteinID: ACO76607
UniProt: C1DIB0
LinkDB All DBs
Position
complement(326764..327015)
Genome map
AA seq 83 aa AA seqDB search
MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDSNLCTECVGHYDEPQCQQVCPVDCIP
HDENRVESREELMRKYLIITGKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaagatcaccgacgattgcatcaactgcgacgtctgcgaacccgagtgcccg
aacggcgccatctcccagggggaagagatctacgtgatcgactccaacctgtgcaccgag
tgcgtcggccactacgacgaaccccaatgccagcaggtctgtccggtggactgcatcccg
cacgacgagaaccgcgtcgagagtcgcgaggaactgatgcggaaatacctgatcatcacc
ggcaaagcctga

DBGET integrated database retrieval system