KEGG   Azotobacter vinelandii DJ: Avin_05780Help
Entry
Avin_05780        CDS       T00885                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Avin_05780
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Avin_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ACO76831
UniProt: C1DKG8
LinkDB All DBs
Position
555577..556266
Genome map
AA seq 229 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLDYRLRPVNIGKGEQFAPEFLRIAPNNRIPAIVDHAP
DDGGEPLALFESGAILEYLADKSGRFLPRETRPRFQALQWLYWQMGGLGPMAGQNHHFVR
YAPEPIPYAIERYVKETTRLYGVLDRQLQGRDYVAGDYSIADMAIYPWAKLWEGQRQRIE
DFPAMAAWLERIAARPAVQRAYALAEQVNADPGALLTAEARRVLFGQER
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactactggaccacccccaacggccacaagatcaccctctttctcgag
gaaaccggactggattaccgcctgcgcccggtgaacatcggcaagggcgagcagttcgcc
ccggagttcctccggatcgccccgaacaaccggattccggcgatcgtcgaccatgcgccg
gacgacggcggcgagccgctggcgctgttcgagtccggcgccatcctcgaatacctggcg
gacaagagcgggcgcttcctgccccgggaaacccgcccgcgtttccaggcattgcagtgg
ctgtactggcagatgggcgggctggggccgatggccggacagaaccaccacttcgtccgc
tatgcgccggaaccgattccctacgccatcgagcgctacgtgaaggagaccacgcgcctg
tacggtgtgctcgaccgccagttgcaggggcgcgactacgtggccggcgactactccatc
gccgacatggcgatctacccctgggccaagctctgggaggggcagcgccagcgcatcgag
gacttccccgccatggccgcctggctcgaacgcatcgccgcgcggccggcggtgcaacgc
gcctatgccctggccgagcaggtcaacgccgaccccggcgcgctgctcaccgccgaggcg
cgccgggtgctgttcggtcaggagcgctga

DBGET integrated database retrieval system