KEGG   Azotobacter vinelandii DJ: Avin_15420Help
Entry
Avin_15420        CDS       T00885                                 

Definition
(GenBank) Aminotransferase, class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00220  Arginine biosynthesis
avn00250  Alanine, aspartate and glutamate metabolism
avn00290  Valine, leucine and isoleucine biosynthesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01130  Biosynthesis of antibiotics
avn01210  2-Oxocarboxylic acid metabolism
avn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Avin_15420
   00290 Valine, leucine and isoleucine biosynthesis
    Avin_15420
   00220 Arginine biosynthesis
    Avin_15420
Enzymes [BR:avn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Avin_15420
    2.6.1.66  valine---pyruvate transaminase
     Avin_15420
Amino acid related enzymes [BR:avn01007]
 Aminotransferase (transaminase)
  Class I
   Avin_15420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Arc
Motif
Other DBs
NCBI-ProteinID: ACO77757
UniProt: C1DRL9
LinkDB All DBs
Position
complement(1514208..1515419)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKKVEGIGIEDIYLGNGVSELIVMVLQALLNNGDE
VLIPAPDYPLWTAATSLAGGKAVHYLCDEQSNWYPDIADIEAKITRNTKALLLINPNNPT
GAVYPREVLERIVEVARQHNLVIFSDEIYDKILYDDAQHISTASLAPDVLCLTFNGLSKA
YRVAGFRSGWVAISGPRHKAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLIL
PGGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLQEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKTYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagtaaatcgaacaagctcgccaacgtctgctacgacattcgcgggccggtg
ctcaagcacgccaagcgtctggaggaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgttcggtttcgaggcccccgaggaaatcctccaggacgtgatccgcaac
ctgcccaccgcccagggctacagcgactccaaggggctgttcagcgcccgcaaggcggtg
atgcagtactaccagcagaagaaggtggaaggcatcggcatcgaggacatctacctgggc
aacggtgtgtccgagctgatcgtcatggtcctgcaggccctgctcaacaacggcgacgaa
gtgctgatcccggcgcccgactacccgctgtggacagcggccaccagcctggccggcggc
aaggcggtgcattacctgtgcgacgagcagtcgaactggtatcccgacatcgccgacatc
gaggccaagatcacccgcaacaccaaggcgctgctgctgatcaacccgaacaaccccacc
ggcgcggtctacccgcgggaagtgctcgagcggatcgtcgaggtcgcccggcagcacaac
cttgtgatcttctccgacgagatctacgacaagatcctctacgacgacgcccagcacatt
tccaccgcctccctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaggcc
taccgggtggcaggcttccgctccggctgggtagccatctccggtcccaggcacaaggcg
cagagctacatcgagggcctcgacatcctcgccaacatgcgcctgtgcgccaacgtaccg
gcccagcacgcgatccagaccgccctcggcggttaccagagcatcaacgacctgatcctg
cccggcggccgccttctggagcagcgcaaccgtacctgggagttgctcaacgacattccc
ggagtcagttgcgtcaagccgatgggcgcgctctacgcctttccgaagatcgaccccaag
gtctgcccgatccacaacgacgagaaattcgtcctcgacctgctgctgcaggaaaagctg
ctgatcgtccagggcaccgccttcaactggccgtggccggaccacttccgcgtggtcacc
ctgccgcgggtcgacgacctcgaacaggccatcggccgcatcggcaacttcctcaaaacc
taccgtcaataa

DBGET integrated database retrieval system