KEGG   Azotobacter vinelandii DJ: Avin_26320Help
Entry
Avin_26320        CDS       T00885                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Avin_26320
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Avin_26320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin AlaDh_PNT_C K_oxygenase NAD_binding_7 FAD_binding_3 FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACO78808
UniProt: C1DJN9
LinkDB All DBs
Position
2688591..2690156
Genome map
AA seq 521 aa AA seqDB search
MLDESLKTQLQAYLERVTLPFEIVASLDGSAKSQEMLGLLQDIQALSDKIALRTDGKDAR
VPSFALERPGADISLRFAGIPMGHEFTSLVLALLQVGGYPPKASEDTIAQVKALEGEYRF
ETYFSLSCQNCPDIVQALNLMAVLNPRVSHVAIDGALFQDEVEKRQIMAVPTIYLNGELF
GQGRMELEQIIAKLDTGASAREAEKLNAREAFDVLVIGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVPETEGPKLARALEEHVRQYEVDIMNLQRAVKLVPAAAKGG
LHEVRFESGAALKARTVIIATGARYRALGVPGEQEYRTKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLLTHGEALRADAVLQRKLHSLPNITVLLNAPIAEVLGDG
QKVNGLVYKDRLGGEAHRIELEGVFVQIGLLPNTEWLKGSVELTERGEIITDAHGATTVP
GVFAAGDATTVPYKQIVIAVGEGAKASLGAFDHLIRSSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgagagccttaagacccaactgcaggcctatctggaacgcgtcaccctgccc
ttcgagatcgtcgccagcctcgacgggagtgccaaatcccaggaaatgctcggcctgctg
caggacatccaggcgctgagcgacaagatcgccttgcgcaccgacggcaaggacgcgcgc
gtcccgtccttcgccctggagcgcccaggcgcggacatttccctgcgcttcgccggcatc
cccatgggccacgaattcacctccctggtgctggccctgctgcaggtcggcggctacccg
cccaaggccagcgaggacaccatcgcccaggtcaaggcgctggagggcgaataccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacatcgtccaggcgctgaacctg
atggcggtgctcaaccccagggtcagccatgtcgccatcgacggcgcgctgttccaggac
gaagtcgagaagcgccagatcatggccgtgccgaccatctacctgaacggcgagctgttc
ggccagggtcgcatggagctggaacagatcatcgccaagctcgacaccggcgccagcgcc
cgcgaggcggagaagctcaacgccagggaagccttcgacgtgctggtgatcggtggcggc
ccggccggcgcctcggcggccatctacgcggcgcgcaagggcatccgcaccggcgtggcg
gccgagcgcttcggcggccaggtgctggataccatggccatcgagaacttcatctccgtg
ccggagaccgaaggcccgaaactcgcccgcgccctggaagagcacgtccgccagtacgag
gtcgacatcatgaacctgcaacgcgcggtcaagctggtgccggctgccgccaagggcggt
ctgcacgaggtgcggttcgagtccggcgccgcgctcaaggccaggaccgtgatcatcgcc
accggcgcccgctaccgcgccctcggcgtgcccggcgagcaggaataccgcaccaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcgtcgtcgcccacgtc
accctgctgacccacggcgaggcgctgcgcgccgacgcggtgctgcaacgcaagctgcac
agcctgccgaacatcaccgtgctgctcaacgcgccgatcgccgaagtgctcggcgacggc
cagaaggtcaacggtctggtctacaaggaccgcctcggcggcgaagcgcaccgtatcgag
ctggagggcgtgttcgtgcagatcggcctgctgccgaacaccgagtggctgaagggctcc
gtcgaactcaccgagcgcggcgagatcatcaccgatgcccacggcgccaccacggttccc
ggcgtgttcgccgccggcgacgccaccacggtgccctacaaacagatcgtcatcgccgtg
ggcgaaggcgccaaggcttcgctgggcgccttcgaccacctgatccgcagttcggctccg
gcctga

DBGET integrated database retrieval system