KEGG   Azotobacter vinelandii DJ: Avin_36380
Entry
Avin_36380        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avn  Azotobacter vinelandii DJ
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ACO79785
UniProt: C1DRC7
LinkDB
Position
3701738..3703303
AA seq 521 aa
MTVTLYTNDYLEYYLTLVGWLVNNGIWNLISDTGLFAVPFIVIVAREWLKVRQEGADEGN
KGVLSLARIETHLYVGYMVVSLAGIPAVHVGLDTLQFDQERAQQCQTTVPAPADTGWSTT
FSSLAGKSAQVPIWWAFMHALSKGITSGAVAAIPCGTDLRQMRMEVDATRIANPLLAQEV
ADFSHDCFGPSRARLFMRQPDLGAMANDAKALQDLNWIGSRFFLDTAGYYDTDYSKTPRA
AWPYDAKRDVGLPQVTGGGGYPTCKQWWSDSGKGLRARLQAQVAPDLLTRFQGWANWLSQ
EEVTDAVIRELVSPNRQLAGAVYSDYGGRAGEGQTISHALTRTLGTIGIITGATEYFPGV
DIVRQGLPMVLAFLKMAMVICLPMVLLIGAYQLQVAMTMSVIYFAIMFVDFWFELARWVD
STILDALYGSGLQSLTFDPLIGMQNESQSILLNYVIGAMFIILPMFWVGALGWAGIQAGK
VLEGLSDGTKAAQNAGTKGFGVVNDTYSGAKSGFNKGKKGD
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaccgtcacgctctacaccaacgactacctggagtattacctgacgctggtcggctgg
ctggtcaacaacgggatctggaacctgatttccgacaccggcctgttcgccgtgccgttc
atcgtcatcgtcgcccgcgaatggctgaaggtccgccaggaaggcgccgacgagggcaac
aagggcgtcctctcgctcgcccggatcgagacgcacctctatgtcggctacatggtcgtc
tccctcgccggtataccggccgtccacgtcggcctcgacaccctccagttcgaccaggag
cgcgcccagcaatgccagaccaccgtgccggcgccggccgacaccggctggagcacgacc
ttcagcagcctggccggcaagagcgcccaggtgccgatctggtgggccttcatgcacgcg
ctgtccaagggcatcaccagcggcgcggtagcggcgatcccctgcgggacggaccttcgc
cagatgcgcatggaggtcgacgcgacgcggatcgccaaccccctgctcgcccaggaagtg
gccgacttcagccacgactgcttcggcccctctcgggccaggctcttcatgcggcagccg
gacctcggcgcaatggccaacgatgcgaaggccctgcaggacctgaactggatcggcagc
cgcttcttcctggacaccgccggctactacgacaccgactattccaagacacccagggcg
gcctggccctacgacgccaagcgcgacgtcgggctgccccaggtcaccggaggcggcggc
tatccgacgtgcaagcagtggtggtccgacagcgggaaaggcctgcgggcccgcctgcag
gcccaggtcgccccggatctactgacccggttccagggctgggcgaactggctgtctcag
gaggaagtcaccgatgcggtgattcgggaactcgtctcgcccaatcggcaactcgctgga
gcagtttattcggattacggcggacgggctggtgagggacaaacgatctcgcatgccctg
accagaacgctcggcaccatcggtatcatcaccggcgccaccgaatacttccctggtgtg
gacatcgttcggcaagggctgcccatggtgttggcgttcctgaagatggcgatggtcatc
tgcctgcccatggtgctgctcatcggcgcctaccaactgcaagtggccatgacgatgagc
gtgatctatttcgcgatcatgttcgtcgacttctggttcgaactggctcgctgggtcgat
agcacgattctcgatgctctatatggttcgggattgcagagcttgaccttcgacccgctt
ataggcatgcaaaacgaatcacagagcattctgctcaactacgtgataggcgcgatgttc
attatccttcctatgttctgggttggggcgctgggctgggccggcatccaggcaggcaag
gtattggaaggactgtcagacggaactaaagccgctcaaaatgccgggactaaaggtttt
ggagttgtaaacgacacgtacagcggagctaaaagcggcttcaacaaaggaaagaaagga
gactaa

DBGET integrated database retrieval system