KEGG   Azotobacter vinelandii DJ: Avin_45250Help
Entry
Avin_45250        CDS       T00885                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01130  Biosynthesis of antibiotics
avn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avin_45250 (aroK)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Avin_45250 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin AAA AAA_16 ABC_tran AAA_5 RuvB_N AAA_24 AAA_29 dNK AAA_22 Guanylate_kin RNA_helicase TsaE Rad17 PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ACO80639
UniProt: C1DHQ6
LinkDB All DBs
Position
complement(4590865..4591383)
Genome map
AA seq 172 aa AA seqDB search
MRNVILVGPMGSGKSTIGRLLAKELRLAFKDSDKEIEQRTGADIPWIFDVEGEAGFRERE
QAMIGELCASDGIVLATGGGAVLRSENRAALRSGGRIVYLHASVAQQLERTSRDRNRPLL
HSADPGRVLSDLMLVRDPLYREIADLVVETDERPPRMVVEEILDRLHTLPPR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaatgtaatcctcgtgggcccgatgggctcgggcaagagcaccatcgggcgtttg
cttgccaaagaattgcggttggcgttcaaggattccgacaaggaaatcgagcagcgtacc
ggcgccgacattccctggatcttcgacgtggaaggcgaggcgggcttccgcgagcgcgag
caggcgatgatcggtgagctttgcgccagcgacggcatcgtgctcgccaccgggggcggc
gccgtgctgcgctccgagaatcgcgccgccctgcgttcgggcgggcggatcgtttacctg
cacgcctcggtcgcccagcaactggagcgcacttcccgcgaccgcaatcgtccgttgctg
cattccgccgatccgggacgggtcctgagcgacctgatgctcgtccgggaccccctgtac
cgagagatcgccgacctggtggtggaaaccgacgaacgcccgccacgcatggtcgtggag
gaaatcctcgaccgcctgcacacgttgccgccacggtga

DBGET integrated database retrieval system