KEGG   Azotobacter vinelandii DJ: Avin_48570Help
Entry
Avin_48570        CDS       T00885                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:avn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Avin_48570 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avn02000]
    Avin_48570 (pstB)
Enzymes [BR:avn01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Avin_48570 (pstB)
Transporters [BR:avn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Avin_48570 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_16 AAA_22 AAA_29 AAA_23 AAA_15 Rad17 AAA_33 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACO80958
UniProt: C1DK53
LinkDB All DBs
Position
complement(4918322..4919155)
Genome map
AA seq 277 aa AA seqDB search
MQQESASHGINLDALGRKKQTFDLASEPVALEVPGLKLFYGDKQALYDVRMNIPKNRVTA
FIGPSGCGKSTLLRCFNRMNDLVDGCRVEGGIKLDGQDIYRKGVDVAELRRRVGMVFQKP
NPFPKSIYENVVYGLRIQGINKKRTLDDAVEWALKGAALWDEVKDRLHDSALGLSGGQQQ
RLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIFELKSKYTIVIVTHNMQQAARVSD
YTAFMYMGKLIEYGDTDTLFTNPAQKQTEDYITGRYG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagaatccgctagccacggcatcaatctcgacgcccttggccgcaagaagcag
accttcgacctggccagcgagccggtggctctcgaggtccccggcctcaagctgttctac
ggcgacaagcaggcgctctacgacgtccgcatgaacattccgaagaaccgcgtgaccgcc
ttcatcgggccgagcggctgcggcaagtcgaccttgctgcgttgcttcaaccggatgaac
gatctggtcgacggctgtcgcgtggagggagggatcaagctcgacgggcaggacatctac
cgcaagggcgtggacgtcgccgaactgcgccggcgcgtcggcatggtgttccagaagccc
aaccccttccccaagagcatctacgagaacgtggtctacggcctgcgcatccagggcatc
aacaagaagcgcacgctggacgatgcggtcgagtgggcactgaagggtgccgcgctgtgg
gacgaggtcaaggaccgcctgcacgattccgccctcggcctttccggcggccagcagcag
cgtctggtcatcgcccgcaccatcgcggtcgagccggaggtgctgttgctcgacgagccc
tgttcggcactcgatccgatctccactctcaaggtcgaggaactgatcttcgagctgaag
tccaagtacaccatcgtcatcgtcacccacaatatgcagcaggctgcccgggtgtccgac
tacaccgcgttcatgtacatgggcaagctgatcgaatacggcgacaccgacaccctgttc
accaacccggcgcagaagcagaccgaggactacatcaccggccgttacggctga

DBGET integrated database retrieval system