KEGG   Azotobacter vinelandii DJ: Avin_50650Help
Entry
Avin_50650        CDS       T00885                                 

Gene name
modC1
Definition
(GenBank) Mo transporter, inner membrane ATP-binding component, ModC1
  KO
K02017  molybdate transport system ATP-binding protein [EC:7.3.2.5]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:avn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Avin_50650 (modC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avn02000]
    Avin_50650 (modC1)
Enzymes [BR:avn01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     Avin_50650 (modC1)
Transporters [BR:avn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    Avin_50650 (modC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE AAA_21 AAA_23 AAA_22 AAA_16 AAA_29 SMC_N AAA_25 RsgA_GTPase AAA_33 cobW AAA_30 LRV
Motif
Other DBs
NCBI-ProteinID: ACO81153
UniProt: C1DLG0
LinkDB All DBs
Position
complement(5133460..5134602)
Genome map
AA seq 380 aa AA seqDB search
MNTSFEPGTKGETGALSGGLPADGIRARFRVDYAGFALDVDLTLPGHGVTALFGHSGSGK
TTLLRCVAGLERAAEARLEINGELWQDSAAGVFLPTHRRALGYVFQEASLFPHLSVRRNL
EYGMKRVDAASRQVSWERVLELLGIGHLLERLPGRLSGGERQRVGIARALLTSPRLLLMD
EPLAALDLKRKNEILPYLERLHDELDIPMLFVSHLPDEVARLADHVVLLDQGRVTAQGSL
QDIMARLDLPTAFHEDAGVVIESVVAEHDDHYHLTRLAFPGGAVLVARRPEAPGQRLRLR
VHARDVSLANSRIEDSSITNVLPATVREVVEADTPAHVLVRLEAEGTPLIARITRRSCDQ
LGIAPGRRMWAQIKAVALLG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccagcttcgagcccggcaccaagggcgaaaccggtgcactttcgggcggcttg
ccggcggacggcatccgcgcccgtttccgggtggattacgcggggttcgcgctggatgtc
gacctgaccctgccggggcatggcgtgaccgcgctgttcggccattccggctccggcaag
accaccctgctgcgctgcgtcgccggcctggagcgggccgccgaggcgcgtctggagatc
aacggcgagctctggcaggacagcgccgccggggtgttcctgccgacccacaggcgcgcc
ctcggctatgtgttccaggaggccagcctgttcccccatctgagcgtgcggcgcaacctg
gaatacggcatgaagcgcgtcgatgccgccagccgccaggtgtcctgggagcgggtgctg
gaactgctcggcatcggccacctgctcgagcgcctgcccggccgcctgtccggtggcgag
cgccagcgcgtcggcatcgcccgcgcgctgctcaccagcccgcgtcttctgttgatggac
gagccgctggcggcgctcgacctcaagcgcaagaacgagatcctgccctatctggagcgt
ctgcacgacgaactggacatcccgatgctgttcgtcagccacttgccggacgaggtggcg
cgcctcgctgaccatgtggtgctgctcgaccaggggcgcgtgacggcgcagggctcgctg
caggacatcatggcgcggctcgacctgccgaccgcctttcacgaggatgccggggtggtc
atcgagtcggtggtggccgagcacgacgaccactaccacctcacccgtctcgcctttccc
ggcggcgcggtgctggtcgcgcggcgcccggaggcgcccggccagcgcctgcgcctgcgc
gtgcacgcccgcgatgtcagcctggcgaacagccgcatcgaggactccagcatcaccaac
gtattgccggccactgtccgcgaggtggtcgaggccgataccccggcccatgtgctggta
cgtctggaggccgagggcactccgctgatcgcccgcatcacccgccgttcctgcgaccag
ctcgggatagcccctggcaggcgcatgtgggcgcagatcaaggcggtggcgctgctcggc
tga

DBGET integrated database retrieval system