KEGG   Aeromonas veronii TH0426: AMS64_08255Help
Entry
AMS64_08255       CDS       T04529                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00020  Citrate cycle (TCA cycle)
avo00190  Oxidative phosphorylation
avo00650  Butanoate metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
avo01130  Biosynthesis of antibiotics
avo01200  Carbon metabolism
Module
avo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMS64_08255 (sdhA)
   00650 Butanoate metabolism
    AMS64_08255 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AMS64_08255 (sdhA)
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AMS64_08255 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AMS64_08255 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AMQ42370
UniProt: A0A2S3XMC0
LinkDB All DBs
Position
1745208..1746974
Genome map
AA seq 588 aa AA seqDB search
MTIPTREFDAVVIGAGGAGMRAALQIAQSGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HDDNWQWHMYDTVKGSDYIGDQEAIEYMCKTGPEAIYELENMGLPFSRFDNGSVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNVKNKTTVFSEWYALDLVKNQDGHVVGC
TAIDMESGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVGVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPIIPTCHYMMGGV
PTNVNGQCLTQDKNGNDVPVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLV
NTLGEMEHGRDASESDLDAALARFNRWENCRDGEDPVQIRKDLQRCMQNNFSVFREGAAM
AEGLAELKLIRERLKSARLDDTSKEFNTQRIECLELDNLMETAFATAVAANFRTESRGAH
CRFDFPDRDDENWLCHSLYHPDTESMTRRAVNMSPKTREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccaactcgtgaatttgatgcggtggtgattggtgccggtggtgccggtatg
cgcgccgcgctgcagattgcccagtccggcaagagctgcgctctgttgtccaaggttttt
ccaacccgttctcacactgtctccgcccagggcgggatcacggttgcgctgggcaatgcc
cacgatgacaactggcagtggcatatgtatgacacggtaaaaggttccgattacatcggt
gatcaggaagccattgagtacatgtgcaaaaccggtcccgaggctatctatgagctggag
aacatggggctgcccttctcccgtttcgataacgggtctgtctaccagcgtccgtttggt
ggtcagtccaagaatttcggtggcgagcaggctgcccgtactgccgctgcggccgaccgt
accggtcacgccctgctgcacaccctttaccaacaaaacgtcaagaacaagaccaccgtc
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggccacgtggtgggttgt
accgccatcgatatggagagcggtgaagtggtctacttcaaggcaaaggccaccgtgctg
gccaccggcggtgccggtcgtatctaccagtccaccaccaacgcccacatcaacacaggt
gacggtgtcggcatggcgctgcgtgccggcgtcggcgtgcaggacatggagatgtggcag
ttccacccgaccggcatcgccggggccggggtgctggtaactgaaggctgccgtggtgaa
ggcggctatctgctcaataaagatggcgagcgcttcatggagcgttacgccccgaacgcc
aaggacttggccggtcgcgacgtggtggcccgctccatcatgatcgagatccgtgaaggc
cgtggctgcgacggtccctggggcccgcacatcaagctgaagctggatcacctcggcaaa
gaggtgctggaatcccgtctgccggggatctgcgagctctctcgcaccttcgcccacgtg
gatccggtcaaagagccgatcccgatcattccgacctgccactacatgatgggcggcgtg
ccgaccaacgtgaatggccagtgcctgactcaggacaagaacggcaacgatgtaccggtg
gtcggtctgtttgcggtgggcgagattgcctgcgtctccgtacacggcgccaaccgtctg
ggtggcaactccctgctggatctggtggtcttcggccgcgctgccggcatgcatctggtc
aacactctgggcgagatggagcacggccgcgatgcttccgagtcggatctggatgccgcg
ttggcccgcttcaaccgctgggaaaattgccgtgacggggaagacccggtgcagatccgc
aaagacctgcagcgctgcatgcagaacaacttctccgtatttcgcgaaggtgcggcgatg
gcagaagggttggccgagctcaagcttatccgcgagcgcctcaagtcagcccgtctggat
gacacctccaaagagttcaacacccagcgcatcgagtgcctggagctggacaacctgatg
gagacggcgtttgccacggcggttgccgccaacttccgtaccgagagtcgcggtgctcac
tgccgctttgacttcccggatcgcgacgatgagaactggctgtgccacagcctctatcat
ccggacaccgagtccatgacccgtcgcgctgtcaacatgtcacccaagacccgtgaggcg
ttcccgcccaaggtccggacttactga

DBGET integrated database retrieval system