KEGG   Aeromonas veronii TH0426: AMS64_08260Help
Entry
AMS64_08260       CDS       T04529                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00020  Citrate cycle (TCA cycle)
avo00190  Oxidative phosphorylation
avo00650  Butanoate metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
avo01130  Biosynthesis of antibiotics
avo01200  Carbon metabolism
Module
avo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMS64_08260 (sdhB)
   00650 Butanoate metabolism
    AMS64_08260 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AMS64_08260 (sdhB)
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AMS64_08260 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AMS64_08260 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AMQ42371
UniProt: A0A0T6TVR0
LinkDB All DBs
Position
1746991..1747707
Genome map
AA seq 238 aa AA seqDB search
MNVTFSVYRYNPDVDNVPHMKEYRLDIPEGSDMMVLDALIQLKELDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPLSDLLKKGNNVVIRPLPGLPVIRDLVIDMTQFYTQWEKVKPF
LINDDKLPPVREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
WLADSRDTATTERLGNLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGQIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacattctctgtctacagatacaatccggatgttgataacgtcccccatatg
aaggaatatcgtcttgatattcctgaaggttccgacatgatggtgctcgacgcactgatc
cagttgaaagagctggatcccacgctcgccttccgccgctcttgccgcgaaggggtctgt
ggatcagatggtctcaacatgaatggcaagaacggtcttgcctgtatcaccccgctctcc
gacctgctgaagaagggcaataacgtcgttatccgccccttgcccggcctgccggtgatc
cgtgatctggtgatcgacatgacccagttctacacccagtgggagaaggtcaaacccttc
ctcatcaatgatgacaagttgccgccggtgcgtgagcacctgcaatcccccgaagagcgc
gccaagcttgacggcctgtacgagtgcattctctgtgcctgctgctccacttcgtgcccc
tccttctggtggaatcccgacaagttcatcggtccggccgggctgctcgccgcctaccgc
tggctggctgacagccgcgataccgcgaccaccgaacgactggggaatctggacgacgca
ttcagcgtgttccgctgccatggcatcatgaactgcgtgaacgtctgtccgaaaggcttg
aacccgaccaaggcgattggccagatcaagtcgatgttgctcaatcgggctgtttag

DBGET integrated database retrieval system