KEGG   Aeromonas veronii TH0426: AMS64_12735Help
Entry
AMS64_12735       CDS       T04529                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00473  D-Alanine metabolism
avo01100  Metabolic pathways
avo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMS64_12735
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AMS64_12735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avo01011]
    AMS64_12735
Enzymes [BR:avo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AMS64_12735
Peptidoglycan biosynthesis and degradation proteins [BR:avo01011]
 Precursor biosynthesis
  Racemase
   AMS64_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMQ43165
LinkDB All DBs
Position
2778986..2780212
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLIFGLLAGQAVAAPYLPLATDHRNGQEQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKANIPCIGIASNEEARVAREKGFTGRLMRV
RAATPDEVEQALPYKMEELIGSLVSAQGIADIAQRHHTTIPVHIALNSAGMSRNGIDLRL
AGAKQDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLAVPDAYFDMVRPGGLLYGDSIPSHTEYKRVMAFKTQVASVNHYAAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGDAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaaaactctgctggctaccctgatcttcggcctgctcgcgggccaagccgtt
gcggctccctatctgccccttgcgacggatcatcgcaacggccaggagcaaaccgccagc
aacgcctggttggaagtggatctgggcgcctttgaacacaatatccagaccctcaaggat
cgcctcggcgacaagggcccgcagatctgcgccatcatgaaggccgacgcttatggtcat
ggcatcgacctgctggtcccctccgtggtcaaggccaatatcccctgcatcggcatcgcc
agcaacgaagaggcgcgcgtcgcccgcgagaagggctttaccggccgtctgatgcgggtg
cgtgctgccaccccggatgaagtagagcaggccctgccctacaagatggaggagctgatc
ggcagtctggtcagtgcccagggtatcgccgatatcgcacagcgccaccacaccaccatt
ccggtgcatattgcactcaactccgccggcatgagccgcaacggcatcgacctgcgtctg
gccggtgccaagcaggatgcgctggctatgctcaagctaaaggggatcaccccggtcggc
atcatgacccacttcccggtggaagagaaagaggacgtcaagatggggctggcccagttc
aaactggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggcagtgccagacgcctacttcgacatggtgcgc
ccgggcggcctgctctacggcgactccatcccctcccacaccgaatacaagcgggtgatg
gcattcaagacccaggtcgcctcggtcaaccactatgcagcgggcaacaccgtcggttat
gaccgcacctttactctcaagcgtgactcctggctcgccaacctgccgctgggctactcc
gatggctatcgccgcgccctcagcaacaaagcctatgtgctgatccagggtcagaaggtg
ccggtggtcggcaagacttccatgaacaccatcatggtggatgtgacggatctgaaaggg
gtgaaacccggtgacgaggtggtgctgtttggccgtcagggtgacgccgaagtgaaacag
gcggatctggaggagtacaacggcgccctgctggcggacatgtacaccatctggggctac
accaaccccaagaagatcaaacgctga

DBGET integrated database retrieval system