KEGG   Aeromonas veronii TH0426: AMS64_15000Help
Entry
AMS64_15000       CDS       T04529                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
avo  Aeromonas veronii TH0426
Brite
KEGG Orthology (KO) [BR:avo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMS64_15000
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AMS64_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AMQ43561
UniProt: A0A142E5X3
LinkDB All DBs
Position
complement(3269402..3270064)
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
DDFAVFESGAILIYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIYDWSGISIEGLPH
LQAWMDRMAEKPACQKGITIPPRKEQPDELIKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacttttacaccgccgcgacccccaatggtttcaaagtggcgatcgccctcgaa
gagctgggtttgccctatcgggtcattcctcttgatctctcggcactggatcagaagaag
cccgagtttcttgccatcaatcccaatggccgcattccggccatcgtcgatcgggataac
gacgatttcgccgtattcgagtcgggggccatcctcatctatctggcggagaaagcaggc
aagttgttgcccgctgatcccaaacgccgctctcaggccatccagtggctgatgttccag
atgggcggggtaggacccatgatggggcaggccaacgtcttctaccgctacttccccgag
aagatccccgccgccatcgaacgctaccagaaggaggggcgccgcctgttcgaggtgctc
gacagccatctggctcatcacgaatatctggcggacgagtacagcatcgccgatatcgcc
acctggccctgggtgcggatttatgactggagcggcatctccatcgaagggttaccccat
ctgcaagcctggatggatcgcatggcagagaaacctgcctgccagaaggggatcaccata
ccgccgcgcaaagagcagccggatgagctgatcaagcaggcacaacagatggtaacacgt
tga

DBGET integrated database retrieval system