KEGG   Aeromonas veronii TH0426: AMS64_17070Help
Entry
AMS64_17070       CDS       T04529                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00250  Alanine, aspartate and glutamate metabolism
avo00280  Valine, leucine and isoleucine degradation
avo00410  beta-Alanine metabolism
avo00640  Propanoate metabolism
avo00650  Butanoate metabolism
avo01100  Metabolic pathways
avo01120  Microbial metabolism in diverse environments
Module
avo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMS64_17070
   00650 Butanoate metabolism
    AMS64_17070
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMS64_17070
   00280 Valine, leucine and isoleucine degradation
    AMS64_17070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMS64_17070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:avo01007]
    AMS64_17070
Enzymes [BR:avo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMS64_17070
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AMS64_17070
Amino acid related enzymes [BR:avo01007]
 Aminotransferase (transaminase)
  Class III
   AMS64_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMQ43933
UniProt: A0A142E6Z5
LinkDB All DBs
Position
3728203..3729492
Genome map
AA seq 429 aa AA seqDB search
MSQSESNKAWQARREAAVVNGVGTLLPVFIDRAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVREQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVAPYKTGFGPFPGEIYHIPFPADYLG
VSEEDALHALELCFSADIEPSRVAAIIIEPVQGEGGFYPASPSFMQKLRSVCDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEIMNSAKPGGLGGT
YAGSPIACAAALAVLQVIDEEKLNQKALDQGEQIKAGLERIAERFDCIGQIRGPGAMVAM
ELVKRRDASQPDPDLTKRLVAEAGKRGLVLLSCGVRANVIRFLAPLTAPAAVIDEGLQLL
EKSLEAVLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtcagaatcaaacaaggcgtggcaagcgcgccgcgaagcggccgtggtcaac
ggcgtcggtaccctgctgccggtctttatcgaccgggcgcaaaatgccgagctgtgggat
gtggagggcaaccgctacatcgactttgcctccggcatcgccgtgctcaataccggccac
aaccacccgaaagtggtggcggcagtgcgtgaacagctggaaaagttcagccacacctgc
tttcaggtcaccccctaccccggctatatcgagcttgccgagaagctcaacgccctggta
cccggcccgaccccgaagcgcaccctgtttctctccaccggcgccgaggcggtcgagaac
gccatcaagattgcccgcgcccacaccggtcgcagcggcaccatcgccttcaaggggggc
tttcacggtcgcaccatgatgggcatggcgctcaccggcaaggtggccccctacaagacc
ggctttggccccttcccgggggagatctaccacatccccttccccgccgattatctcggg
gtgagtgaagaggatgccctgcacgccctcgagctctgcttcagcgccgatatcgagccg
agcagggttgccgccatcattatcgagccggtacagggcgaagggggcttctatcccgcc
tccccgagctttatgcagaagctgcgcagcgtctgcgaccagcacggcattctgctgatc
tgcgacgagatccagagcggtttttgccgcaccggcaagaccttcgccaccgagtatgcc
ggcatcgagccggacatcatgacgttggccaagagtctggcgggtggcttccccctctca
gccgtggtgggcaaggcggagatcatgaactcggccaaaccgggtggtctgggtggcacc
tatgccggttcccccatcgcctgcgccgccgcgctggcggtattgcaggtgatagacgag
gagaaactcaaccagaaagcgctggatcagggggagcagatcaaggcggggctggaacgc
atagccgagcgttttgactgcataggtcaaattcgcggccccggtgccatggtggccatg
gagctggtgaaacggcgtgatgccagccagcccgatcccgacctcaccaaacgtctggtg
gccgaggcgggcaaacgcggtctggtcctgctctcatgcggggtgcgcgcaaatgtcatc
cgttttctcgcccccctgacagcccctgcggcagtgattgacgaggggttgcaactcctt
gaaaaatcactggaggccgtgctggcctga

DBGET integrated database retrieval system