KEGG   Aeromonas veronii TH0426: AMS64_17985Help
Entry
AMS64_17985       CDS       T04529                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00061  Fatty acid biosynthesis
avo00780  Biotin metabolism
avo01100  Metabolic pathways
avo01212  Fatty acid metabolism
Module
avo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMS64_17985
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AMS64_17985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avo01004]
    AMS64_17985
Enzymes [BR:avo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AMS64_17985
Lipid biosynthesis proteins [BR:avo01004]
 Fatty acid synthase
  Component type
   AMS64_17985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AMQ44106
UniProt: A0A0T6SJV0
LinkDB All DBs
Position
complement(3948921..3949382)
Genome map
AA seq 153 aa AA seqDB search
MTTEKKSLGIQEIMDLLPHRYPFLMVDRVDDYEISDERKTLRAIKNVSFNEPIFQGHFPA
KPVFPGVLILEAMAQATGILAFTMVGKPSPNELYYFASIDNARFKRPVGPGDQLVLDVEF
LKERRGIAKFTGVATVDGEVVCTAELMCAKREV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgaaaagaagagcctgggtatccaggaaatcatggatctgctgccccaccgt
tatccgtttctgatggtggatcgtgtagacgactacgagatcagcgatgagcgcaaaacc
ctgcgtgccatcaagaacgtctcgttcaacgagccgatcttccaggggcacttcccggcc
aagccggtgttcccgggcgtactgatcctggaagcgatggcacaggccaccggtatcctg
gcctttaccatggtgggcaagccgtctcccaacgaactctactattttgcctcaatcgac
aacgctcgcttcaagcgtccggtcggccccggtgaccaactggtgctggacgtggagttc
ctgaaagagcgtcgcggtattgccaagttcaccggtgtcgccaccgtcgacggtgaagtg
gtctgtaccgccgagctgatgtgcgccaaacgcgaggtttaa

DBGET integrated database retrieval system