KEGG   Aeromonas veronii B565: B565_0339Help
Entry
B565_0339         CDS       T01462                                 

Definition
(GenBank) Peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
avr  Aeromonas veronii B565
Pathway
avr00550  Peptidoglycan biosynthesis
avr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B565_0339
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    B565_0339
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
    B565_0339
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:avr03036]
    B565_0339
Enzymes [BR:avr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B565_0339
Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   B565_0339
Chromosome and associated proteins [BR:avr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    B565_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AEB48374
LinkDB All DBs
Position
360438..362192
Genome map
AA seq 584 aa AA seqDB search
MKRKATAKAAKANVKAPSIYPWRFRTLAVFIGIAFVGLILRLAWIQVINPDRLRQEGDMR
SLRTTSTQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHESGAINNERAWLALSAVLKLD
INTLKHRIANPSKRFVYLQRQVTPAVAEYIKGLKLGGVYLRPEARRFYPTGEISAHLVGV
TNIDGSGIEGIERSYNEWLTATPGEMRVRKDRQGRVIERLGIVKEGKNANDLQLSIDQRV
QALAYRALKRATDENKATSGSMVMLDIKTGEVLAMVNTPSYNPNNRGQYQSFRVRNRVVT
DTYEPGSTVKPLILLSALQAGVTSWKDFIPGGPLFIGAKQIKDVSIHKATNLYDILRYSS
NIGMSRIALRMPAQEMINTLSMFGFGMDTGSGLMGESSGMLPQRRRWSDIERATLSFGYG
LRVTPLQLASAYATLANKGKRVPLSIVKVTTPPKGEQVIDHNNAAAMLQALEYVVDNAIP
KAKIPGYRVGGKSGTAKVAVAGGYGKDYMAWFAGFAPASDPRFVMVVVINEPKGSAYYGG
AVATPPFAEAMGGVLQLFNIRPDAVPPAVPTKLARTEASLVPRT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaggctacagccaaagctgccaaagcgaatgtcaaagcgccatcgatctat
ccgtggcgctttcgcacgcttgcggtgtttatcggcatcgcgtttgtgggtctgatcctg
cgtctggcctggatccaggtgatcaatccggatcgtctgcgtcaggaaggggatatgcgt
tccctgcgtaccacctctacccaggcggtgcgcggcatgatcaccgatcgcaacggcgag
cagctggcggtttctgtgccggtcgaagctgtctgggccgatcccaagacggtgcatgaa
tctggtgccatcaataatgagcgcgcctggctggcgctctccgccgtgctcaagctcgac
atcaataccctcaaacaccgcatcgccaaccccagcaaacgcttcgtctatctgcagcgt
caggttactcctgcggtggcggaatatatcaaggggctcaagctggggggcgtctacctg
cgccccgaagcacgccgcttctacccgaccggcgagatcagcgcccatctggtgggggta
accaacatcgatggcagcggtattgaagggatcgagcgcagctacaacgagtggctgacg
gcgacacccggcgaaatgcgggtgcgcaaggatcgtcaggggcgcgtcatcgagcggctt
ggcatcgtcaaagagggcaagaacgccaacgatctgcagctcagtatcgatcagcgggtg
caggctctggcctaccgagccctcaagcgggcaaccgacgagaacaaggcgacctccggc
tccatggtgatgctggatatcaagaccggtgaagtgctcgccatggtcaacaccccctcc
tataacccgaacaaccgcggccagtatcagagcttccgggtacgcaaccgggtggtgact
gatacctacgagccgggttcgaccgtcaagccattgattttgctcagcgccttgcaggca
ggtgtcaccagctggaaagatttcattcccggtggtccgctctttatcggtgccaagcag
atcaaggacgttagtatccacaaggcgaccaacctctacgatatcctgcgttactcctcc
aacatcggtatgtcgcgtatcgcgctgcggatgccggcgcaggagatgatcaataccctc
agcatgttcggtttcggcatggataccggcagcgggctgatgggcgagagcagcggcatg
ctgccccagcgtcgtcgctggtccgatatcgagcgagcaaccctctcgttcggttatggt
ctgcgagtcaccccgctgcagctggcttccgcctacgccaccctggccaacaagggcaaa
cgggtgccgctctccatcgtcaaggtgactacgccgcccaagggtgagcaggttatcgat
cacaacaacgccgctgccatgttgcaggcgctggagtatgtggtcgacaacgccattcca
aaagccaagatcccgggctatcgggtcggtggcaagagtggtaccgccaaggtcgccgtc
gccggtggctatggcaaggattacatggcctggtttgccggtttcgcacccgccagtgat
ccccgtttcgtcatggtggtggtgatcaacgagccaaaaggcagcgcctattatggcggc
gccgtggcgaccccaccgtttgcagaggccatgggcggggtgctgcagctcttcaatatt
cgtcccgatgcggtgccgccagcggtgcccaccaaacttgcccgtacggaggcttctctt
gtcccgcgcacttga

DBGET integrated database retrieval system