KEGG   Aeromonas veronii B565: B565_0656Help
Entry
B565_0656         CDS       T01462                                 

Definition
(GenBank) Penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
avr  Aeromonas veronii B565
Pathway
avr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B565_0656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:avr01003]
    B565_0656
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
    B565_0656
Enzymes [BR:avr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     B565_0656
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B565_0656
Glycosyltransferases [BR:avr01003]
 Polysaccharide
  Bacterial polysaccharide
   B565_0656
Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   B565_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AEB48691
LinkDB All DBs
Position
complement(715554..717872)
Genome map
AA seq 772 aa AA seqDB search
MATQRRKRAPKKAAPKRTIWRKLFWLGFKLSLVVAAFMVVFGIYLDTKVRERFDGEKWQL
PVMVYSRPLELYPSQRLSRDQMLRELNMLSYKQVRQPHTPGEYTINGNRIELIRRPFEFY
DGADGARGLRLTFNGPRLEGIQSLENQRQLGYAQMDPVLLDRLNTEDREDRLLVRIAEVP
DSLLVTLLTTEDRDFYQHGGVSPVAIMRAMFANLIAGRTVQGGSTLTQQLAKNFFLTRER
SLWRKLQEAYMAVLIDYRYSKDEILESYLNEVYLGQNFSQGVYGFGLASYFYFGIPVNEL
DIDQVALLVGLVKGPSYYDPWRFPERAKTRRDLVLKLLMDHGSLTQAEYELASRQPLGII
ARGQMSYGRTPAFMGLLKREIQSRFGADLLKQSGLKIFTSLDPIAQHAAERAVESGLADI
EKLRGKKKLEAAMVVSDWHKGEVVALVGGRDPRYAGFNRALDARRQIGSLVKPAVYLTGL
SNGLTLATPLKDQPIRIRGQDGQVWTPQNYDRKFRQSVPLMDALASSLNVPTVNLGLQVG
LEKVVDTLHKLGVQQEIQPYPSLVLGAVALSPLEVNQMYLPIANQGLTQPLSAIRAVVNG
DGSLLYQHDQTAKRVTDQQASWLTLFAMTKTVSQGTARALSAKFPGATMAAKTGTTNELR
DSWFAGMDNNELVSIWVGRDDNTPAGLTGASGALQLFSGYMSQRGVNSLGLKMPEGVTWA
NFSRASGTRVTSDCPGSLQVPAKASTMGSPAGCASSVTPRSALDDWFGGFFN
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaacgacgcaagcgtgcccccaagaaggcagcgcccaaacgcaccatctgg
cgcaagctgttctggcttggcttcaagctctccctggtggtggcggcctttatggtggtg
tttggcatctacctcgataccaaggtgcgcgagcgcttcgatggcgagaagtggcagctg
ccggtgatggtctacagccgcccgctggagctctaccccagccagcgcctgtcgcgggac
cagatgctgcgcgagctcaacatgctgagctacaagcaggtgcgccagcctcacacgccg
ggtgaatacaccatcaacggcaatcgcatcgagctgattcgccgtccgttcgagttctat
gacggcgccgatggagcccgcggcctgcgcctcaccttcaacggcccgcgccttgagggg
atccagtcgctggagaaccagcgccagctcggttacgcccagatggacccggtgctgctc
gatcgcctcaataccgaagatcgggaagatcgcctgctggtgcgtatcgccgaagtgccc
gacagcctgctggtgaccctgctcaccaccgaagatcgcgacttctaccagcatggcggc
gtctcgccggtggccatcatgcgcgccatgttcgccaacctgatcgcgggtcgcaccgtg
caggggggcagtaccctcacccagcagctggccaaaaacttcttcctgacccgtgagcgc
agtctgtggcgaaaactgcaggaagcctatatggcggtgctgatcgactatcgctacagc
aaggacgagatcctcgagtcctacctcaacgaggtctatctggggcagaacttctcgcaa
ggggtctacggtttcggcctcgcctcctacttctacttcggcattccggtcaacgagctg
gatatcgatcaggtcgccctgctggtcggtctggtaaaaggcccctcctattacgatccc
tggcgcttcccggagcgggccaagacccgccgtgatctggtgctgaagctgctgatggat
cacggcagcctgacccaggccgagtatgaactggccagccgtcaacccctcggcatcatc
gcccgtggccagatgagttatggccgcaccccggcctttatgggactgctcaagcgggag
atccagagccgcttcggcgccgatctgctcaagcagtccggcctcaagatcttcaccagt
ctcgaccccatcgcccagcatgcggccgagcgagcggtcgaatcgggcctcgccgatatc
gagaaactgcgcggcaagaagaagctggaggcggccatggtggtctccgactggcacaag
ggcgaagtggtggcactggtgggtggccgcgatccccgctacgccgggttcaaccgggcg
ctggatgcccgccgccagatcggctcgctggtgaaaccggcggtctacctgaccggtctc
tcaaacggcctgacgctcgcgaccccactcaaagatcagccgatccgcattcgcggtcag
gatggtcaggtctggacgccgcaaaactacgatcgcaagttccgccagagcgtgccgctg
atggatgcgctggccagctcactcaacgtgccgaccgtcaatctgggtctgcaagtcggg
ctggagaaggtagtcgataccctgcacaagctgggagtccagcaggagatccagccctac
ccgtcgctggtgctgggggcggtggccctctccccgctggaggtgaaccagatgtatctg
cccatcgccaatcaggggctaacccagccgctgtcggccattcgcgccgtagtcaacggg
gatggcagcctgctctatcagcatgatcagaccgccaagcgggtcaccgaccaacaggcg
agctggctgaccctgttcgccatgaccaagacggtgagtcagggcacggcccgcgccctc
agtgccaagttccccggcgccaccatggcggccaagacaggcaccaccaacgagctgcgc
gactcctggtttgccgggatggacaacaacgaactggtcagtatctgggtcggtcgcgac
gacaacaccccggcgggcttgaccggtgccagcggtgccctgcagctctttagcggctac
atgagccagcgcggcgtcaacagtctgggattgaagatgccggaaggggtcacctgggcc
aacttctcccgcgccagcggcacccgcgtcaccagcgactgcccgggcagcctgcaggtg
ccggccaaagcctccaccatgggctccccggccggttgcgccagcagtgtgacgccacgc
agtgcgctggatgactggttcggcggtttcttcaactag

DBGET integrated database retrieval system