KEGG   Aeromonas veronii B565: B565_1094Help
Entry
B565_1094         CDS       T01462                                 

Definition
(GenBank) Pyruvate kinase II
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00230  Purine metabolism
avr00620  Pyruvate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
avr01230  Biosynthesis of amino acids
Module
avr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avr_M00002  Glycolysis, core module involving three-carbon compounds
avr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
avr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_1094
   00620 Pyruvate metabolism
    B565_1094
  Nucleotide metabolism
   00230 Purine metabolism
    B565_1094
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     B565_1094
Membrane trafficking [BR:avr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    B565_1094
Exosome [BR:avr04147]
 Exosomal proteins
  Proteins found in most exosomes
   B565_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-ProteinID: AEB49129
LinkDB All DBs
Position
1208532..1209971
Genome map
AA seq 479 aa AA seqDB search
MPRRTKIVTTLGPATDREGILEGIIRAGADMVRMNFSHGTAEDHILRANQVRDIAAKLGR
HVAIMGDLQGPKIRVSTFKDGKIYLAIGDKFILDAALGKGEGCQEQVGIDYKSLPDDVVQ
GDILLLDDGRVQLKVEQVEGTRIHTTVTVAGPLSNNKGINKKGGGLSAPALTEKDKEDIK
TAARMNVDYLAVSFPRCGDDLRYARELAREAGSNAKIVAKVERAETVATDEAMEDIILGS
DAVMVARGDLGVEIGDPELVGVQKKLIRHSRRLNRVVITATQMMESMINAPLPTRAEVMD
VANAVLDGTDAVMLSAETAAGQFPIETVTSMASVCVGAEKHPSLNVSNHRMSYTFTSVEE
AVAMSTMYAANHLEGVKAIVALTESGTTPLLMSRISSGLPIFAMSPHNKTLAWTNLYRGV
TPVMFDGDETKPVYEVCRDALAVLKDKGLLQSGDMVLLTHGDKMETVGSTNTCKVMMVE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcctagacgtacaaagattgtaaccacactcggtccggctaccgaccgcgaagggatc
ctcgaagggatcatccgcgccggggccgacatggtgcggatgaatttctctcacggcact
gctgaagaccatatcctgcgcgccaatcaggtgcgtgacattgctgccaagctcggtcgt
catgttgccatcatgggggatctgcaaggcccgaaaatccgtgtttccactttcaaggat
ggcaaaatctatctggccatcggtgacaagttcattctcgacgcggcactcggcaagggt
gaaggttgtcaggagcaggtcggtatcgactacaagagcctgccagacgatgtggtgcag
ggcgacatcctgctgctggacgatggccgtgtgcagctgaaggtcgagcaggttgaaggc
acccgcattcataccacggtgaccgtggccgggccgctctccaacaacaagggtatcaac
aagaaagggggcggtctctccgctccggccctgaccgagaaagacaaagaagacatcaag
actgctgcccgtatgaatgtggactatctggcggtctccttcccccgttgtggcgatgat
ctgcgctacgcccgcgagctggcccgcgaagccggttccaatgccaagatcgtggccaag
gttgagcgcgccgaaaccgtcgccaccgatgaggcgatggaagacatcatcctcggttcc
gatgctgtgatggtcgcccgtggcgatctgggtgtcgagatcggtgaccccgagctggtt
ggcgtacagaagaagctgatccgccactcccgtcgtttgaaccgtgtggtgatcaccgct
acccagatgatggagtcgatgatcaatgcgcctctgccgactcgtgcagaggtcatggac
gtggccaacgccgtgctggatggtaccgatgcggtgatgctctccgctgagactgctgcc
ggtcagttccccatcgagaccgttacctccatggcgagcgtctgtgtcggtgccgagaag
cacccgagcctgaacgtctccaaccaccgcatgagctacaccttcacttccgttgaagaa
gctgtagccatgtccaccatgtatgcggccaaccacctggaaggggtgaaggcgatcgtg
gcactgaccgagtccggcaccacgccgctgctgatgtcccgtatcagctccggtctgccg
atcttcgccatgtctccccacaacaagaccctggcctggaccaatctctaccgtggcgtc
actccggtgatgtttgacggtgacgagaccaaaccggtctacgaagtgtgccgcgacgcg
ctggccgtgctcaaggataaggggctgctgcaaagcggcgacatggtgctgctgactcac
ggtgacaagatggaaaccgtgggtagtaccaacacctgcaaggtgatgatggtcgaataa

DBGET integrated database retrieval system