KEGG   Aeromonas veronii B565: B565_1137Help
Entry
B565_1137         CDS       T01462                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
avr  Aeromonas veronii B565
Brite
Enzymes [BR:avr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B565_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEB49172
LinkDB All DBs
Position
complement(1249813..1250397)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
NGGIFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAINKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaacttcccgctctgccctatgcaatcaacgctctggaaccgcacatctcc
caggaaactctggaatatcaccacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
aacggcggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccaaatggtggtggtgagccgactggcgccctggctgatgccatcaacaaggca
ttcggctccttcgccgagttcaaagatgccttcaccaaatcagccatcggcaacttcggt
tccagctggacctggctggtgaagaaagctgacggctctctggctatcgtcaatacctcc
aacgctggctgcccgctgactgaagccggtaccaccccgctgctgactgttgacctgtgg
gagcacgcctactacatcgacttccgcaacctgcgtccgaagtacatggaaaccttctgg
gctctggttaactgggaattcgtggccaagaatctggctgcctaa

DBGET integrated database retrieval system