KEGG   Aeromonas veronii B565: B565_1395Help
Entry
B565_1395         CDS       T01462                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
avr  Aeromonas veronii B565
Pathway
avr00473  D-Alanine metabolism
avr01100  Metabolic pathways
avr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B565_1395
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    B565_1395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
    B565_1395
Enzymes [BR:avr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B565_1395
Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
 Precursor biosynthesis
  Racemase
   B565_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEB49430
LinkDB All DBs
Position
complement(1539429..1540655)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLIFGLLAGQAVAAPYLPLATDHRSGQEQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKANIPCIGIASNEEARVAREKGFTGRLMRV
RAATPDEVEQALPYKMEELIGSLVSAQGIADIAQRHHTTIPVHIALNSAGMSRNGIDLRL
ADAKQDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLAVPDAYFDMVRPGGLLYGDSIPSHTEYKRVMAFKTQVASVNHYAAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRSLSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGDAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaaaactctgctggctaccctgatcttcggcctgctcgcgggccaagccgtt
gcggctccctatctgccccttgcgacggatcatcgcagcggccaggagcaaaccgccagc
aacgcctggttggaagtggatctgggcgcctttgaacacaatatccagaccctcaaggat
cgcctcggcgacaagggcccgcagatctgcgccatcatgaaggccgacgcttatggtcat
ggcatcgacctgctggtcccctccgtggtcaaggccaatatcccctgcatcggcatcgcc
agcaacgaagaggcgcgcgtcgcccgcgagaagggctttaccggccgtctgatgcgggtg
cgtgctgccaccccggatgaagtagagcaggccctgccctacaagatggaggagctgatc
ggcagtctggtgagtgcccagggtatcgccgatatcgcccagcgccaccacaccaccatt
ccggtgcatatcgcgctcaactccgccggcatgagccgcaacggcatcgacctgcgtctg
gccgatgccaaacaggatgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatgggactggcacagttc
aaactggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggccgtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctctacggtgactccatcccctcccacaccgaatacaagcgggtgatg
gcattcaagacccaggtcgcctcggtcaaccactatgcagcgggtaacaccgtcggttat
gaccgcacctttactctcaagcgtgactcctggctcgccaacctgccgctgggctactcc
gatggttatcgccgctccctgagcaacaaggcctatgtgctgatccagggtcagaaggtg
ccggtggtcggcaagacctccatgaacaccatcatggtggatgtgactgatctgaaaggg
gtgaaacccggcgacgaggtggtgctgtttggccgtcagggtgacgccgaagtgaaacag
gcggatctggaggagtacaacggcgccctgctggcggacatgtacaccatctggggctac
accaaccccaaaaagatcaaacgctga

DBGET integrated database retrieval system