KEGG   Aeromonas veronii B565: B565_1996Help
Entry
B565_1996         CDS       T01462                                 

Definition
(GenBank) Beta-ketoacyl-acyl carrier protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
avr  Aeromonas veronii B565
Pathway
avr00061  Fatty acid biosynthesis
avr00780  Biotin metabolism
avr01100  Metabolic pathways
avr01212  Fatty acid metabolism
Module
avr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B565_1996
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B565_1996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:avr01004]
    B565_1996
Enzymes [BR:avr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     B565_1996
Lipid biosynthesis proteins [BR:avr01004]
 Fatty acid synthase
  Component type
   B565_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB50031
LinkDB All DBs
Position
complement(2233703..2234896)
Genome map
AA seq 397 aa AA seqDB search
MGNTAESSWQALLNGQSGISLIEHFDASEFATRFAGLVKDFDPEQYGINRKDARKMDLFI
QYGIAAGMQALDDSGLTINEENAERVGVAIGSGIGGLGLIEQNHESLVNGGPRKISPFFV
PSTIINMVSGHLSIMKGMQGPNIAVTTACTTGTHAIGMAGRMIAYGDADVMVAGGAEKAS
TAMGMGGFAAAKALSNRNDEPQKASRPWDKDRDGFVLGDGAGVLVLEEYEHAKARGAKIY
AELVGFGMSGDAYHMTAPPADGNGGARAMKNAIKDAGIAPEQIGYINAHGTSTPLGDVAE
LRGMKSVFGEHAKSLMVSSTKSMTGHLLGAAGAIEAIITVLALRDQVAPPTINLDNPDDE
CDLDLVPHVAKPGSFEYALSNSFGFGGTNGSLIFKRV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaacactgccgaatccagctggcaagcactgctcaacgggcagagcggcatttcc
cttatcgaacattttgatgccagcgagtttgcaacccgcttcgcaggtctggtcaaggat
ttcgatccagagcagtacggtatcaaccgtaaagacgctcgcaaaatggatctcttcatt
caatacggcatcgcggccggtatgcaggcgctggatgattccggcctgaccatcaatgaa
gagaatgccgagcgtgtcggcgtggcgattggctccggtatcggcggtctgggtctgatt
gaacagaaccacgaaagtttggtcaacggcggcccgcgcaagatcagtcccttcttcgtt
ccgtccaccatcatcaatatggtgtccggtcatctctccatcatgaaaggtatgcaaggg
ccgaacatcgccgtgacgaccgcctgtaccactggtacccatgccatcggcatggctggc
cggatgatcgcttacggtgatgccgacgtgatggtcgccggcggtgccgagaaagcctcc
accgcgatggggatgggtggttttgctgccgccaaggcactctccaaccgcaacgacgag
ccgcaaaaagcgagccgtccgtgggataaggatcgcgacggtttcgtgctgggtgacggt
gccggtgtactggtgctggaagagtacgaacacgccaaggcccgtggcgccaagatctac
gccgagctggtcggttttggtatgagcggtgacgcgtaccacatgactgcgcctcctgca
gatggcaacggtggtgctcgcgccatgaaaaatgccatcaaggatgccggcattgccccc
gagcagattggttacatcaacgcgcacggtacctccaccccgctgggtgatgtggccgag
ctgcgtggcatgaagtcggtgtttggtgagcacgccaaatccctgatggtgagctccacc
aagtcgatgaccggtcacctgttgggcgccgccggtgccatcgaggcgatcatcactgtg
ttggccctgcgtgatcaggtggctccgcccaccattaacctggacaacccggatgatgag
tgcgatctggatctggtaccccatgtggccaagccaggtagcttcgagtacgccctttcc
aactcgtttggttttggcggcaccaatggctcactgatcttcaaacgcgtataa

DBGET integrated database retrieval system