KEGG   Aeromonas veronii B565: B565_2860Help
Entry
B565_2860         CDS       T01462                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
avr  Aeromonas veronii B565
Pathway
avr00250  Alanine, aspartate and glutamate metabolism
avr00280  Valine, leucine and isoleucine degradation
avr00410  beta-Alanine metabolism
avr00640  Propanoate metabolism
avr00650  Butanoate metabolism
avr01100  Metabolic pathways
avr01120  Microbial metabolism in diverse environments
Module
avr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B565_2860
   00650 Butanoate metabolism
    B565_2860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B565_2860
   00280 Valine, leucine and isoleucine degradation
    B565_2860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B565_2860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:avr01007]
    B565_2860
Enzymes [BR:avr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B565_2860
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B565_2860
Amino acid related enzymes [BR:avr01007]
 Aminotransferase (transaminase)
  Class III
   B565_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEB50895
LinkDB All DBs
Position
3217693..3218982
Genome map
AA seq 429 aa AA seqDB search
MSQSESNKAWQARREAAVVNGVGTLLPVFIDRAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVREQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHIPFPADYLG
VSEEDALHALELCFSADIEPSRVAAIIIEPVQGEGGFYPASPSFMQKLRSVCDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEIMNSAKPGGLGGT
YAGSPIACAAALTVLQVIEEEQLNQKAQAQGEQIKAGLQRIAERFDCIGQIRGPGAMVAM
ELVKRRDASQPDPDLTKRLVAEAGKRGLVLLSCGVRANVIRFLAPLTAPAAVIDEGLQLL
EKSLEAVLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcagaatcaaacaaggcgtggcaagcgcgccgcgaagcggccgtggtcaat
ggcgtcggtaccctgctgccggtctttatcgaccgggcgcaaaatgccgagctgtgggat
gtggagggcaaccgctacatcgactttgcctccggcatcgccgtgctcaacaccggtcac
aaccacccgaaagtggtggcagcggtgcgcgagcagctggaaaaattcagccacacctgc
tttcaggtcactccctacccgggctatatcgagcttgccgagaagctcaacgccctggtg
cccggcccgaccccgaagcgcaccctgtttctctccaccggcgccgaggcagtcgagaac
gccatcaagattgcccgcgcccacaccggtcgcagcggcaccatcgccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtgccctacaagacc
ggctttggccccttcccgggggaggtctaccacatccccttccccgccgattatctcggg
gtgagtgaagaggatgccctgcacgccctcgagctctgcttcagcgccgatatcgagccg
agccgggttgccgccatcattatcgagccggtacagggcgaagggggcttctatcccgcc
tccccgagctttatgcagaagctgcgcagcgtctgcgaccagcacggcattctgctgatt
tgtgacgagatccagagcggtttctgccgcaccggcaagaccttcgccaccgagtatgcc
ggcatcgagccggacatcatgaccctggccaagagtctggcgggtggcttccccctgtca
gccgtggtgggcaaggcggagatcatgaactcggccaagccgggtggtctgggtggcacc
tatgccggttcccccatcgcctgcgctgccgcgctgacggtcttgcaggtgatcgaagag
gagcagctcaaccagaaggcccaggcgcaaggtgagcagatcaaggcggggctgcaacgc
atagccgagcgttttgactgcataggtcaaattcgcggccccggtgccatggtggccatg
gagctggtgaaacggcgtgatgccagccagcccgatcccgaccttaccaagcgactggtg
gccgaggcgggcaaacggggtctggtccttctctcatgcggggtgcgcgcaaatgtcatc
cgttttctcgcccccctgacagcccctgcggcagtgattgacgaggggttgcaactcctt
gaaaaatcactggaggccgtgctggcctga

DBGET integrated database retrieval system