KEGG   Aerococcus viridans: AWM76_08950Help
Entry
AWM76_08950       CDS       T04270                                 

Definition
(GenBank) anthranilate synthase subunit I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
avs  Aerococcus viridans
Pathway
avs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avs01100  Metabolic pathways
avs01110  Biosynthesis of secondary metabolites
avs01130  Biosynthesis of antibiotics
avs01230  Biosynthesis of amino acids
avs02024  Quorum sensing
Module
avs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AWM76_08950
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AWM76_08950
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AWM76_08950
Enzymes [BR:avs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AWM76_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N SIC
Motif
Other DBs
NCBI-ProteinID: AMC01667
LinkDB All DBs
Position
complement(1887930..1889393)
Genome map
AA seq 487 aa AA seqDB search
MIRPSLEEARQLGKDHTIIPIALEIFSDVATSIEVLRTISKQSDHFYLLESVVNKDNWSR
YSFLGYKPNLSIYSIDGQVTVQEGKHEESFQADDPLASLNDILDRCKSPSIDYLPPFTGG
LVGYLSYDCIKYTEPSLQLTKNNPENFRDYHFMLMDKVIAFDHFRQKIVLIVNIETDKLE
ENYIQGATDLKDMEQMIMRPDPVIEEDLTQDVGDFEALFSQEDYERIVEKIQHHIVEGDI
FQAVVSNRFKAPFAGSLLQTYRLLRTINPSPYMVYMHFDDLEIACASPETLVSVRNGVAS
SFPLAGTVPRGATDAEDRALVEGLLQNKKELAEHDMLVDLARNDIGKVAEFGTLEVSEYR
AIKQFSHVSHISSKVTAKVRPDATCLDVLKSALPAGTLSGAPKIRACQLIDEIEDTKRGP
YGGALGYIDFAGNMDMCIGIRMAVLKNDQVFVQSGAGIVADSAPEKEYLETKNKAKAMMT
ALGHEEA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgattagaccaagtttagaagaggcgagacagttagggaaagaccatacgattatccca
attgctttagagattttttccgatgtagcaacctcaatcgaagtgctgagaacgatcagc
aaacaatctgaccacttttacctactagagagtgtggtgaataaggataactggagtcgt
tattcttttcttggctataaaccgaacttgtcgatctactcaatagacggtcaagtaacc
gtgcaagagggtaagcatgaagaaagcttccaagcagatgatccactagcatccttgaac
gatatccttgaccgttgtaagagtccaagtattgattatttaccgccttttacaggaggt
ttggttggttacttgtcttatgactgcatcaaatatacggaaccatctctacagttaacg
aaaaataacccagaaaatttccgggactaccatttcatgttgatggataaagtcattgcc
tttgaccacttccgccaaaagattgtcttaatcgtcaatattgaaaccgacaaattagaa
gaaaactacatccaaggggctacagacctgaaggatatggagcagatgattatgcgtcca
gaccctgttatcgaggaggacttgacccaagacgtgggcgactttgaggctttgtttagc
caagaagattacgagcgtatcgtagagaaaatccaacaccatattgtggagggtgacatc
ttccaagcggtggtatccaaccggtttaaggccccatttgccgggtcattactccaaact
tatcgcctgcttcgaacgattaatccgtctccttacatggtctacatgcatttcgatgac
ttagaaattgcgtgtgcatcaccggagacactggtctctgttcgtaacggggtcgcttca
tcctttccattagccggtactgtaccgcgcggggcaacggatgcggaagatagggcatta
gttgaaggcctcttgcaaaataaaaaagagttggctgaacatgacatgcttgttgactta
gcccgtaacgatatcggaaaggtcgctgaattcggtacgctagaagtcagtgaatataga
gccatcaagcagttttcacacgtcagccacatttcatccaaggtaacggccaaagtcaga
ccagacgcgacttgtttagatgtcttaaagtcggcactaccagcgggtactttatctggt
gcccctaagattcgggcctgccaattgattgatgaaattgaagataccaaacgggggcca
tatggcggtgctttaggctatatcgactttgccggcaacatggacatgtgtatcggcatc
cggatggctgtcttgaagaatgaccaagtctttgtccaatctggtgctggaattgtggca
gattcagcccctgaaaaagaatacttagaaacgaagaacaaggccaaagccatgatgaca
gcattaggacacgaggaggcataa

DBGET integrated database retrieval system