KEGG   Aerococcus viridans: AWM76_09075Help
Entry
AWM76_09075       CDS       T04270                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
avs  Aerococcus viridans
Pathway
avs00970  Aminoacyl-tRNA biosynthesis
avs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWM76_09075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:avs03029]
    AWM76_09075
Enzymes [BR:avs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AWM76_09075
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AWM76_09075
Mitochondrial biogenesis [BR:avs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AWM76_09075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln Luciferase_N
Motif
Other DBs
NCBI-ProteinID: AMC01687
UniProt: A0A2J9PMW9
LinkDB All DBs
Position
complement(1921552..1921857)
Genome map
AA seq 101 aa AA seqDB search
MSISEEEVKRIAKLAKFKVEDEDVVHFTEEFGNILNMIEELQEIDTTDVAPMFWAVDFEN
VMREDKVVKMQTRDELFINAKTTVDGFIEVPSIIDTDGGDA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttctgaagaagaagttaaacggattgctaaattagctaaattcaaggttgaa
gatgaagatgtcgttcactttactgaagaatttgggaatattttaaatatgattgaagaa
ttacaagaaatcgatactaccgatgtagcacctatgttttgggcagtcgattttgaaaac
gtgatgcgcgaagataaagttgtgaaaatgcaaacgcgtgatgaattatttatcaacgcc
aaaacaacagtcgatggttttatcgaagtgccatcaattattgatacagatggaggcgac
gcttaa

DBGET integrated database retrieval system