KEGG   Actinomyces sp. VUL4_3: BK816_02220Help
Entry
BK816_02220       CDS       T04541                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
avu  Actinomyces sp. VUL4_3
Pathway
avu00473  D-Alanine metabolism
avu01100  Metabolic pathways
avu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BK816_02220
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BK816_02220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avu01011]
    BK816_02220
Enzymes [BR:avu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BK816_02220
Peptidoglycan biosynthesis and degradation proteins [BR:avu01011]
 Precursor biosynthesis
  Racemase
   BK816_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOZ72259
UniProt: A0A1D9MJA0
LinkDB All DBs
Position
572608..573843
Genome map
AA seq 411 aa AA seqDB search
MTEPSSLYAGQAEIDLSAFAKNLAALQAHAPQAEPLAIVKADAYGHEAKLIAKAAWDQGV
RWLGQAQVQEALNLHAYFDQIGLPSCHEANGPRIFTWIFPSGANGVKARKAAIAAGLDIS
VSNTFELDELLLAYHDLLAEDEATKKPARVHLKIDVGNSRAGATKEHWPELVAATKAAVE
TGIVSLEGIWSHLQSADDPAPEAIAETNQQIDNFEAAIEVAKAAGLSPVRRHLSATSGGL
WHPRAHFDMIRWGIGLYGYSPNPAHPGSPTDLTPVMTLAAPLMSVKQIPAGQGVSYNATW
RAERATWVGLVPLGYADGISRLQSNTAWVTVYHEGEAIPARIIGRVCMDQFMIDLGHGEQ
PRAARGDRVVLFGGEQKAANADDWAKTAQTISYEILTSIGARVPRVPTLTK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccctcttcgctttatgcgggacaagcagaaattgacctgagcgcattcgct
aaaaatcttgccgccttgcaagcccacgcaccccaggctgaaccactagccattgtgaaa
gccgacgcgtatgggcatgaggcaaaactgattgccaaagccgcatgggatcaaggggta
cgatggttaggacaagctcaagtgcaagaagccttaaacttgcatgcctacttcgatcag
atcggtttgccgagttgtcacgaggcgaatgggccacgcatcttcacctggatttttcct
tcaggggctaacggagtaaaggcgcggaaagccgcaatcgcagccggactagatatttcg
gtctctaacacttttgaactcgatgagttgctcttggcctaccatgatttgctggccgag
gacgaagccaccaagaaaccagcgcgcgtgcatttaaagattgacgtagggaattctcgc
gccggcgccaccaaagaacattggccagagctggttgctgccacgaaagcagccgtggaa
actggaatcgtcagtttggaaggcatctggtcacacttgcaaagcgccgatgaccccgcc
ccagaagcgattgctgaaacaaaccagcaaatcgataactttgaagcggcgattgaggtg
gcaaaagctgctgggctctcaccggttcgtcgccacctgtccgccactagtggtgggctg
tggcatcctagagcccattttgacatgatccgttgggggattggcctctatggctattcg
ccgaaccccgcccacccaggttcacctactgatttgacgccggtaatgaccctcgcagcg
ccattgatgtcggtaaaacagatcccggcagggcaaggcgtctcctataacgctacttgg
cgggcagaacgagctacctgggtagggctagttcccctcggttatgccgatggtatctct
cgtctccagtccaatactgcgtgggtgacggtctatcacgagggtgaggccatcccggcg
cggatcattggacgcgtttgcatggaccagttcatgatcgacctcggtcatggcgagcaa
ccccgcgccgccagaggagatcgagtcgtcctatttgggggcgaacagaaggccgcaaat
gccgacgattgggcaaaaacagctcaaacgattagctatgaaatcctcacttccattggg
gcccgcgtaccaagagttcccaccctcaccaaataa

DBGET integrated database retrieval system